VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

IL-17

Gene Name IL-17
Sequence Strain (Species/Organism) Mus musculus
NCBI Gene ID 16171
NCBI Protein GI 6754324
Genbank Accession AC159614
Protein Accession NP_034682
Taxonomy ID 10090
Chromosome No 1
Gene Starting Position 20730904
Gene Ending Position 20734495
Gene Strand (Orientation) +
Protein Name interleukin 17A
Protein pI 9.13
Protein Weight 16001.99
Protein Length 158
Protein Note Also known as Il17; Ctla8; IL-17; Ctla-8; IL-17A
DNA Sequence
>gi|372099109:20730904-20734495 Mus musculus strain C57BL/6J chromosome 1, GRCm38 C57BL/6J
CATCCACCTCACACGAGGCACAAGTGCACCCAGCACCAGCTGATCAGGACGCGCAAACATGAGTCCAGGG
AGAGCTTCATCTGTGGTGAGTCCTGCACTAATGTACAAGGCGCTTGTTGATTGTGACCAGGTTGCGTTAT
TGCACGTGATATGAAATGCTCTATTCCAGCTGTTGGGGTCCATGAATCTGTACATGTAGAACTGGAAATG
AAACCTTTGGTAGATGTCGAAATCATTGTACAGCATTTTCAAGAACTGATAGGCATCAGTCAGAAAGATA
CGGTTAAAACTGAAGGGTTGCTGTGATGAAACTAACCCACTAAGAAATGTCACATGACGCTATGCAATGA
GAAAGACTGTCAAAATCTATTCTTCTGAGTGCAAGGGATTTGACGTCATTCTCTCATGTCAGTGCTCTTT
AATCCAGAATGAAGTGGGCTACTGTTCTTGCAGATTTGAAAGCTTTAGAAGCAAGTTTTCATCCATTGCT
TTATCCCAAAGTCTTAGGATATCCAAACTATTAGATACATGTATAAGTCTCCTTATGAATAAAGCTTTAT
ATATTTTAAATACTTAACCTAAAAAATATGCTCTGCACTCGTATTCTCATGATAGAATCAATGCATGCTA
AATTTAGAACCGGATAATATATACCTAAGAAAACATGAGGGAGGTTCAGTTTCTATCTGGAGGATAGCTG
GTGTACAAACACTGTTTCTAATTCTAACATGAGTGCCGACAAACAACGGGTAGGTTTTCTGCAGTCCTCT
CCTCCAAGGTACATGTTTGACTGTGCACGAGGTTTACAGAAGGAGTGACTAAGAACACTAGTGCATAAGG
ACAAGAAAATCGGGGTCATTCAGCAGCCCACTGACTCATGAGCTAACAGGCTGAGGAGATGGCAGAAGCT
GACATTTTTATTAGGACCACTGCTGTCTAAGACATCACATGATTGTCCTCAGTCACAAAAAGAATGTAAG
AAACTGGTTAAAAATAAAATAAATTCTACATTTTTTAGCATGATTTTGGCCATCTTAAAGTTTTTAAATT
CAGAATTACTTACATATTAGGAGAGATCTTTCCAAAATATCATATGTTTCCTACAGTTAGTTATATACTC
ATCACAATGAGTTTGTCAGAAAGAAAAGCAGATACTAATCCAATCCCCCATCACCTTATCTTTCCCTTCT
AGTCTCTGATGCTGTTGCTGCTGCTGAGCCTGGCGGCTACAGTGAAGGCAGCAGCGATCATCCCTCAAAG
CTCAGCGTGTCCAAACACTGAGGCCAAGGACTTCCTCCAGAATGTGAAGGTCAACCTCAAAGTCTTTAAC
TCCCTTGGCGCAAAAGTGAGCTCCAGAAGGCCCTCAGACTACCTCAACCGTTCCACGTCACCCTGGACTC
TCCAGTACGTAAGAACTCCAGACAAAATAATCTGTGTCCTTCCATTCTCTGATGCACCATGTATACCCTA
AACATGATTTTTCACTTTTTTCCTCTCAGTATCCTCAGAGACCTAGAAGGTCCATTGTGTTAAGCAAAGT
TTCCTCTACAGAGTTCTTGGATAGAGCAGGGAATACTTCCCCCTAACCTGTTATAGTGGTCAATAATGAG
AGAGATCAACCCAAATTATTGATAACCATGATTCTAGCATGAGAGCTCAAGTTGAATGCTGACTTTTTTG
GAAATCAGGATGTTTATGTTTCAACCAGACCTACAATTAAAGAGACTTGATGAAAAATAATTAATAACTA
ACTAGGTATTTTTGTGTCTGACCTGAAGAAGACATAGGAAAACAAAATTTGAATGGCTGGTAGAGGAAGC
ATCCTGCTGGATATGTTTTCTCCTTTGTGAGTTGGATAGACTTGACCTCCATCCCAAGCCCTTTTTTACT
TGACCTGTCTCTGGCATACACTATTTAGACCCCATAAAGGGCTCAGTACTTTGATCATTTGAGGTTATAT
GAATAAATTTCAATGGCAAGGAACCTGTGGAGCCACCTGTCTATAGGATTTTTCTCCTTTTTCCAAAACC
AAGGATAATTCAATCAATCAATTCAAAAATCTAAGTGAACTATTTATTCAGATATTGTAAAGGGACAAGA
AAGAGATTATAAAGGGACTTTTGTTGTTGCTTCTAGCTTTTCATATAACTTCCGTCCCAGGAAGTGTTCT
CAGATATAATTCTGATATTCCTTCTTTCAAAGACCAATGTCACCAAATCAGATGAACAGCCATTTTACTC
CTTGGTCATCTGTCCCTTTGTTGTCTCCTGTCAATCAAATGTACCCTTAAAATTTATCTTTTTTTTTTTT
ATGTTATCTACTTGATGTTAAGTTTCAATCCTCACCTCACTATGGTCTTTAGCTTATTCTGTTTATCTTT
CAAAAAGCATTCTTCTAAATCATTTCCTAAACTTTAAAATTCAAGTTTGTGAAGCTTCAGGTCCAGTTCC
ATGATGGAATGGGTGTCCATCATGTGGAAGACACTGGCTTTGATCCTTATTGCTGCGAAAGAGGAGGAGG
GAGAAAATGAGGAATCCGGGAGGAAAAGATAGAAAGGGGAGAATCTAAATTTTCAGACAAGCCAAAGTTA
GCAACTAACATGCAGAGCTTTGCAGTGCACATGTGTGTCACAGTGCGTTCTTCCTCCCTCCCCCGTTCCT
GCTTTTCCTTCCACTTAAGCAGGACTTCATTTCCTCCTGGCTTTTGTCTCCCCTGCAGCCGCAATGAAGA
CCCTGATAGATATCCCTCTGTGATCTGGGAAGCTCAGTGCCGCCACCAGCGCTGTGTCAATGCGGAGGGA
AAGCTGGACCACCACATGAATTCTGTTCTCATCCAGCAAGAGATCCTGGTCCTGAAGAGGGAGCCTGAGA
GCTGCCCCTTCACTTTCAGGGTCGAGAAGATGCTGGTGGGTGTGGGCTGCACCTGCGTGGCCTCGATTGT
CCGCCAGGCAGCCTAAACAGAGACCCGCGGCTGACCCCTAAGAAACCCCCACGTTTCTCAGCAAACTTAC
TTGCATTTTTAAAACAGTTCGTGCTATTGATTTTCAGCAAGGAATGTGGATTCAGAGGCAGATTCAGAAT
TGTCTGCCCTCCACAATGAAAAGAAGGTGTAAAGGGGTCCCAAACTGCTTCGTGTTTGTTTTTCTGTGGA
CTTTAAATTATTTGTGTATTTACAATATCCCAAGATAGCTTTGAAGCGTAACTTATTTTAATGAAGTATC
TACATTATTATTATGTTTCTTTCTGAAGAAGACAAAATTCAAGACTCAGAAATTTTATTATTTAAAAGGT
AAAGCCTATATTTATATGAGCTATTTATGAATCTATTTATTTTTCTTCAGTATTTGAAGTATTAAGAACA
TGATTTTCAGATCTACCTAGGGAAGTCCTAAGTAAGATTAAATATTAATGGAAATTTCAGCTTTACTATT
TGTTTATTTAAGGTTCTCTCCTCTGAATGGGGTGAAAACCAAACTTAGTTTTATGTTTAATAACTTTTTA
AATTATTGAAGATTCAAAAAATTGGATAATTTAGCTCCCTACTCTGTTTTAAAAAAAAATTGTAACAATA
TCACTGTAATAATAAAGTTTTG
Protein Sequence
>gi|6754324|ref|NP_034682.1| interleukin-17A precursor [Mus musculus]
MSPGRASSVSLMLLLLLSLAATVKAAAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYL
NRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEK
MLVGVGCTCVASIVRQAA
Molecule Role Vaximmutor
Related Vaccines(s) E. coli IreA protein vaccine , Rotavirus VP6 Protein Vaccine , Salmonella Typhimurium asd mutant vaccine , Salmonella Typhimurium asd/rfc mutant vaccine
References