VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

IgM (partial)

Gene Name IgM (partial)
Sequence Strain (Species/Organism) Homo sapiens
NCBI Protein GI 1020017
Other Database IDs CDD:143181
CDD:203725
Taxonomy ID 9606
Gene Strand (Orientation) ?
Protein Name IgM
Protein Length 112
Protein Note Immunoglobulin (Ig) light chain, kappa type, variable (V) domain; cd04980
Protein Sequence
>gi|1020017|gb|AAC41922.1| IgM, partial [Homo sapiens]
EIVMTQSPATLSVSPGERATLSCRASQSVSSNLAWYQQKPGQAPRLLIYGASTRATGIPARFSGSGSGTE
FTLTISSLQSEDFAVYYCQQYNNWPPWTFGQGTKVEIKRTVA
Molecule Role Vaximmutor
Related Vaccines(s) Chloroform-methanol residue (CMR)
References