VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

SodA

Gene Name SodA
Sequence Strain (Species/Organism) Mycobacterium tuberculosis H37Rv
NCBI Gene ID 886174
NCBI Protein GI 15610982
Locus Tag Rv3846
Genbank Accession NC_000962.2
Protein Accession NC_000962.2
Other Database IDs EMBL: AE000516
EMBL: AF061030
EMBL: BX842584
EMBL: X52861
Gene3D: G3DSA:3.90.149.10
GenomeReviews: AE000516_GR
GenomeReviews: AL123456_GR
InterPro: IPR001189
KEGG: mtc:MT3960
KEGG: mtu:Rv3846
LinkHub: P17670
PANTHER: PTHR11404
PDB: 1GN2
PDB: 1GN3
PDB: 1GN4
PDB: 1GN6
PDB: 1IDS
Pfam: PF00081
Pfam: PF02777
PIR: S15205
PRINTS: PR01703
ProDom: PD000475
PROSITE: PS00088
TIGR: MT3960
TubercuList: Rv3846
UniProt: P17670
Taxonomy ID 1773
Gene Starting Position 4320704
Gene Ending Position 4321327
Gene Strand (Orientation) +
Protein Name SUPEROXIDE DISMUTASE [FE] SODA
Protein pI 6.43
Protein Weight 23033.8
Protein Length 207
Protein Note Rv3846, (MTCY01A6.22c), len: 207 aa. sodA (alternate gene names: sodB, sod), superoxyde dismutase (EC 1.15.1.1) (see citations below), equivalent to many e.g. P47201|SODM_MYCAV|SODA|SOD from Mycobacterium avium (206 aa), FASTA scores: opt: 1210, E(): 1.8e-73, (82.5% identity in 206 aa overlap); Q9F9R1|SOD from Mycobacterium paratuberculosis (207 aa), FASTA scores: opt: 1207, E(): 2.9e-73, (81.65% identity in 207 aa overlap); O86165|SODM_MYCLP|SODA|SOD from Mycobacterium lepraemurium (206 aa), FASTA scores: opt: 1204, E(): 4.5e-73, (82.05% identity in 206 aa overlap); P13367|SODM_MYCLE|SODA|ML0072 from Mycobacterium leprae (206 aa), FASTA scores: opt: 1169, E(): 9.6e-71, (80.5% identity in 205 aa overlap); etc. Contains PS00088 Manganese and iron superoxide dismutases signature. BELONGS TO THE IRON/MANGANESE SUPEROXIDE DISMUTASE FAMILY. ALTHOUGH FOUND EXTRACELLULARLY, NO SIGNAL SEQUENCE IS PRESENT. AN ALTERNATIVE SECRETORY PATHWAY MAY BE USED.; sodB; sod
Protein Annotation FUNCTION: Destroys radicals which are normally produced within the cells and which are toxic to biological systems (UniProt: P17670)

CATALYTIC ACTIVITY: 2 superoxide + 2 H(+) = O(2) + H(2)O(2) (UniProt: P17670)

COFACTOR: Binds 1 iron ion per subunit (UniProt: P17670)

SUBUNIT: Homotetramer (UniProt: P17670)

SUBCELLULAR LOCATION: Secreted protein (UniProt: P17670)

SIMILARITY: Belongs to the iron/manganese superoxide dismutase family (UniProt: P17670)

CAUTION: Although found extracellularly, no signal sequence is present. An alternative secretory pathway may be used (UniProt: P17670)
DNA Sequence
>GeneID|886174 [Mycobacterium tuberculosis H37Rv ] 4320704..4321327
gtggccgaatacaccttgccagacctggactgggactacggagcactggaaccgcacatctcgggtcaga
tcaacgagcttcaccacagcaagcaccacgccacctacgtaaagggcgccaatgacgccgtcgccaaact
cgaagaggcgcgcgccaaggaagatcactcagcgatcttgctgaacgaaaagaatctagctttcaacctc
gccggccacgtcaatcacaccatctggtggaagaacctgtcgcctaacggtggtgacaagcccaccggcg
aactcgccgcagccatcgccgacgcgttcggttcgttcgacaagttccgtgcgcagttccacgcggccgc
taccaccgtgcaggggtcgggctgggcggcactgggctgggacacactcggcaacaagctgctgatattc
caggtttacgaccaccagacgaacttcccgctaggcattgttccgctgctgctgctcgacatgtgggaac
acgccttctacctgcagtacaagaacgtcaaagtcgactttgccaaggcgttttggaacgtcgtgaactg
ggccgatgtgcagtcacggtatgcggccgcgacctcgcagaccaaggggttgatattcggctga
Protein Sequence
>gi|15610982|ref|NP_218363.1| SUPEROXIDE DISMUTASE [FE] SODA [Mycobacterium tuberculosis H37Rv ]
MAEYTLPDLDWDYGALEPHISGQINELHHSKHHATYVKGANDAVAKLEEARAKEDHSAILLNEKNLAFNL
AGHVNHTIWWKNLSPNGGDKPTGELAAAIADAFGSFDKFRAQFHAAATTVQGSGWAALGWDTLGNKLLIF
QVYDHQTNFPLGIVPLLLLDMWEHAFYLQYKNVKVDFAKAFWNVVNWADVQSRYAAATSQTKGLIFG
Related Vaccines(s) M. tuberculosis DNA vaccine pAK4-sod
References