VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

Il17f

Gene Name Il17f
Sequence Strain (Species/Organism) Mus musculus
NCBI Gene ID 257630
NCBI Protein GI 119360346
Genbank Accession AC159614
Protein Accession NP_665855
Taxonomy ID 10090
Chromosome No 1
Gene Starting Position 20777145
Gene Ending Position 20784269
Gene Strand (Orientation) -
Protein Name interleukin 17F
Protein pI 8.94
Protein Weight 16848.95
Protein Length 161
Protein Note Also known as C87042; IL-17F
DNA Sequence
>gi|372099109:20777145-20784269 Mus musculus strain C57BL/6J chromosome 1, GRCm38 C57BL/6J
ATTTTTGAATTAAAAATATTTTATTATATAATTAATGGATATATTAATTTTCTACTAAATTGATATATAA
TCAATAGGTCATAAATATATGTATAGTTCCCCTACCAACATAAATATATAATAGTTTATGCCAACTTCAT
TTATATTTACCAAATTTTTCTCTAAAAACACACATACCATGTGTGCTTCTTCCTTGCCAGTCCAGCCCCT
GCTACACAGGCCTCCTCCCATGCATTCTGATTATGTTTGTTTTCTTTCCATCACAAATATGAGCATTTCA
TTGAACTCTACAAGAATGGTACTGCATCAAAGTGACAGTCTTGACAGACAAGAACTGTGGTCATCATCTA
ACACAAAGAGACTGGGCCAAGGGTGCCTTCATTTACCTTTGTTTTTAGGAGTTTAAGTGAGGCATTGGGA
ACACACCAGGACTGGTAACAATTCTAAAGCAAGCCAGAAAGTTCAAGCTATATCTACTGCAGAGCTGCAA
GAATGCCATGCACACCTTACTGAGAGTCCTAGAAAGCATAAAGACTTGGAGATCGGGCTTCACACAGAGC
TCTGGATAAAAGGAGGCTTTTTCTCAGTGGAAGTCTTCAACTGATTTTTGTATGCAGCGTTGTCAGGCCG
CTTGGTGGACAATGGGCTTGACACAGGTGCAGCCAACTTTTAGGAGCATCTTCTCCAACCTGAAGGAATT
AGAACAGCCCTGGGGCTCCCTCCGAAGGACCAGGATTTCTTGCTGAATGGCGACGGAGTTCATGGTGCTG
TCTTCCTGACCCTGGGCATTGATGCAGCCTGAGTGTCTGCACTGGGCCTCAGCGATCTCTGAGGGGAACC
GGTGGGGGTCTCGAGTGATGCTGAAGGAAAAAAATAAAAAGTAAAGCAGGATGCTTGAGGCCAGGGAGAG
GAATAGAGAAGGGTTTCCGCAGCACTAGGTGTTTCCCTTCAGGGGCAGTTCTGAGTTATGCAGGGAGCAG
CGCAGACTCTGAATTCTTGGACCAAGCTCTAGCTGATAAGTAACTTCCTAGACCTCAGATGCCTCCACTA
TAAAACGGGGTTTCTCCCATATCATTCTCTCAGAGAGTTGTTGGGGATATCACATGGTTTGAATGCATAC
AGAGTAACCCCATAAATACTTTGGTTACTCTTAAATCTACATTTTCTTTGCATTAGTGTTATTATTCATC
CTTTAAGCAGAGGTTGAACATCACTAGTAGGTCTTCCAAAGTACAATGCATAAAACTCACTGCTTGGAAA
GCAAAATGAAAGCCTTCAAGGTCTGTGAATCCAGAGCCTCACTTGGTTCCTCTCTTGAGACTCCCCTCTG
GCTGAAGACAGGCAGCCAAGTGAGTCTACCACAGTCTACAAACCTCTCAAGAAGGGAGCTATGTATCAGC
CTCAGAGCACTGCTTTGTCCCTAGAATCTGTTTTTATTCGTGTATTTGAAGAGTATTGATGGGTGGTGAG
TGTTCCCAGGACACAAGACTCTGCCCTATACTACATCTATTTCCCAAGCTGACTTTTCTTCCAAATCCTG
ACTTACCATCCCTACTCAAAGAAAATGTCTAATCTCAGTAGATCCCTAAACGGATTCATTGTTTCCACAT
ATCCTCACAGGCTGAAAAAAATATTAAGACTTCCAATCACATAGGTGACCCAAGGCAAGAAACTGAGTTA
GTGGGAAAGGTGCAACTTCTATTGGAGACGGTGAATGTGAAGCCAGGCCTGGTGGCTCATGCCTGTAATC
CCAAAACTCAGAAGACTGGGGCAGAAAGGATAACCATGTATCTGAGGCTAGCCTTGGCTACCTCATAAGT
TTCTGGGCTACAGAGTGAGGCCTCTATCTCAGAAAAAAAAAAAAAAGTGAATGTGAGTCCTGAATACTCA
TAAGAATGAGGCATTGTAATCAAAATAATGTAGCATGTTTTTCTTTCTTTTCTTTTATTATTTTGGTTTT
TCAAGATAGAATTTCACCATGTAGCTCTGGCTGTCCTGGAACTCATTACATAGACCAAGCTGGCCTTGAA
ATTAGAGATCTGCCTGAGTCTGCCTCCTAAGTGCTGAGGTTAAAGGCATCCACCATTACATTGGGTTTAG
CACATTCCTTTCCATGTAATGTGTCTATCTCTCTTCCTTGACTTACTTGTAATCCCATGGGGAACTGGAG
CGGTTCTGGAATTCACGTGGGACAGAAATGCCCTGGTTTTGGTTGAAGATTCGAATGTCAACTCTCACAG
TGTTATCCTCCAGGGGAGGACAGTTCCCAGCCTTCTGCAAGGCAGGAACCCCTGCTTTGGGGTTCTTCCG
AGCTGCTACCTCCCTCAGAATGGCAAGTCCCAACATCAACAGTAGCAAAGACTTGACCTGGAAAATAGAG
ATTACCACAGGTTAGAGCCCTGGTGGTGGGCAATGTACTTGAACTCTGTATAGGGTCACTTTACAGGATC
AAGGTTTCTTTTTTTTTTTTTTTTTCATGGTTCACTAGCAATGAGAACTGCCGTGTTTAATGTTATCAGG
ATACAAAGCAGAAAGGGTCAGGAGTAAAGCTCTCTGGAGTTTATCTCCGGCCTTATAGTCCACAAAACCT
TTCTCTGGGACATTCCACCAAACCTCACCCTACTGTCAAGGTCCCATATGTAATTCAATTAGAAGTATAT
TTATTGGGATGGAGGAATGGCTCCACAGCTAAGAGCACTGATTGCTCTTCTAGAGGTCCTGAGTTCAGTT
CCCAGCAACCACATAGTGGCTCACAACCATCTGTAATGGCATCCAATGCCCTCTTCTGGTGTGTCTAAAG
GCAGAAACAGTGAACTCTTATACATACAATAAATATTTTTTTAAAAGTATATTTATCAACATTAAATAAT
AAAGATTTTAGCATGTATCACTCAAGAAGTATTTTTTCTGTTCTCTAAAGATGTCATATCTGTGTTCATA
CCAGACTCAGAGTTAACTTCCTGCGAGAGCATAGTTGGTCCATGAAAACTTTCTGAATGAATGAGAGAGT
GGGGAAGTGAATGAACAGGGCAGCCCAGTTAAATTAACCAGTATAGTTATGCCACGCTCATTGAGTAAAA
GGATTATGGGAAACTAAGCACAGCAAAATTTCATTTATCCATGCTAATTGAAAGAAGCAGGGACACTGAT
GACGCCTGGCATCACTCAGAGTGCAGAACCCATTTCTTTTAGCTCTAGAATCTATCTTTTCTGTACTAAC
ACTGAAATCAGTTTCGCTGCTGTTACTAGCGCACACAAAGTGCTCAGTGGAGCTCTAAACACAAGAAGAG
CTAAAACCTCAACAGCTCCCCTTGGGTGCAAATGTCCTTTGCCGTCCCTGCTCACACCTTCCTGGGGAAG
AACAAAGCCCATGGTAAGGCAGAAGAGCTAAGGCTGAGCTTTTCATTTCTGGGCTCCGTGTTGTTCAGGC
TCACACTGTGTAGGTAGGGAAAGTGACTGTGCATGTTGGATTTAAAGATTTGCCTGTTCTTTTCAACATC
CTGGAGGCAAGAAATATGCAGAATAAACAAAGAGGTCATGGAGTCAGCCTGCTGGACTACGATCACTGAT
AATACATTGAAAGCAAGCTGCAGGATGAAACAGATTTGTCTCCAGATAATCAGCAGCCATATGCCTTCGC
CTCTGAAGTCATTCGTTCACTGAGTAGCTAATCCTCGAGGCCACAGTGTTGTGGTTTCAGGCATTATCTC
TAGAGTTAACTGTGTGGAGTCCATAATTCATTTATAGGACTCACCGCACAATGACTTGGTTTCCTACATC
CTCATAAATCCCAAAGATCCCTGTAAGCATGCAGTAGTTCCACAAGGCAACAACGGTTGGCAGTGTATTG
ATGTTACCCTGTGCATGGGATGGATGTAAAATGCAGTCTTCACAGGTGCTTTGAAATTTAGAAAACATAG
TCACACATCTATCAACCACTTCTTTAGATTTCTTAAGTAAATTTCTCCTCCAGAATCTTCTCTTTCTTCT
TATATGTCATGTTTATTGTCTCACTTCTCATTTTGACTAGCAAGACTGAAAGTCACTATAGTTCGGGGTT
ATGTGATTAATGTAAGTTGTTGTGGTGGTTGAACTGCGAAGCAACCTGCATAGGCTTATTTATGTGGATG
CTTGGTCCCCAGTTGGTGGAATTATTTGGGAAGGAGTAGGAGGTGTGGTCTTGTTGGAGGAGGTGTGTCA
CTGAGGTGGGCTTCGAAATTTCAAGTCTTATATCATTCCCAGTTAGTTCTTTCTGCCTCATGGTTATGTC
TTAAGATGTGAACTCCCAGCAACTTCCCCAGCGCCATGCCTACCTTCCTGCCTCCAGCCATGATGATCAA
GCAGCTTAACCCTTGGCAACTGTAAGCCCCAAATTAAACACTTCCTTTTATATGTTGCCATGGTTACAGT
GTTTTATCACAGCAATCGAAAAATAACTAAGACAACGATCATGTCCCTAACAGCTCATTATGTTTCTTTA
TTAATAGCTAGACATTCTTGGAGTATTTTAGAAAATGTTTTCACACAAGATTTGAACAGCTAACTCATAG
ATGAAACTCATCCTAACTATCTAATCAGCTCTCAAAGGACTTATGTCAGAGAGGCAATAAACAACCCGGC
AGGGTTCCCCAGCCTCATCGTGACAATCTATAGGATCCACCTTCTATGGCAAGGCTTGGCCACAGCGACT
GAAGGTCATTACTATTCTTCACATTAGTCTTCACTGTGTCTAATTTCAAGAGCCACGAATTCTAAACACT
CTCTGCACTGCATCAGTAAGACAGAAGTATTGAAAGCCACAAACCACTGTTTGCTTTATGCGTTTTTGGG
GTTTTGTTTGTTTGTTTGTTTGTTTTTTGGTGTTTTGCAGCTCTGATAAGGCTGGTGCTGAGTATGGAAA
AACAATAGAAACAATCCATCTTCTCAGGGGAGTCGGGAGATTTTACAGGTTTAAATTCCACCTTTAAAGG
GGATTGATAGGTGTGATTCAAATCCTGTAGGATGGGAAACAGCTAGGAGAATATTGAAACTGAAGGTGTT
CAGTCATAGAGTGTGAATCTTCCCAGCTTAGCTTTGTACATTACTCTTGTGTGCTCGCTGGTGGCAGAAC
ATCTGCACACTTGCCCCTACACTTTCCTCCCTACACAGGAATGGGTGACAGAGACTGGTCAGCTCCAAGC
TCCATCCAAATTTCCCTCAATTGCCCACAGCATATGTCTTCTCTGCTTGCCCCTCCTCATAATCCCGTTT
CAACACTTCTTGCTCCACCATGTTTCTTGCTGACAATCCAACTGATTTTTTCTCCCCCAAAGCAATAGTA
ATGGTTTGGAGCATTAAACTATCCAAACGATTTTCTTGGCTACAATGGCATTAGGTTGAGAATCTTGCCT
CTCTCGATCATCCACAGATAAGCACACTATTGTTGGGAGTCAGAAAATCTAGATGCAGGTCTCAATATTA
TTATATTAGCAATATATTAGCATTGCAATAGAAAATGACAGCAAATGAAAACAGATGACTGAGCTACTGT
GTAATGGAGAAAATGTTCGTGATCTATTCCTGTGGGTTGACAAGGGTCTGAGAGGTAATAGTAAATCACA
GAGCAAGGCTTGGTGGCACACTCCTGAAGTCCCAACACTCCAAGAGAGCAAAGCAAAAAAGACAGTTCCA
GAGCAGTCTGAGCCCACATAGCAAACTCACGACTATCGTGAGCCACACAGAAGATCTTGTCTCAAGGGCT
GGAGAGATGGCTCAGCGGTTAAGAGCACTGACTGCTCCTCCAGAGGTCCTGAGTTCAATTCCCAGCAACC
ACATGGTGGCTTACAACCACGTGTAATAGTACCTGGTGCCCTCTTCAACAGTGTATTCACATACATTAAA
TAAATAAATAAACAAACAAATAAATAAATAAATCTTTTTTTAAAAATCTTGTCTAAAAAAGCAAAAACAA
TAATATAAAGAATTGGTATTTGTATACTCTTTCTACCTTTACCTCTTATAGCAATTGCAGTGTCCAAGTT
AACTAAAATCTAAGCACTTATGATCTACCTTGCAAGTCTAGATTCATATCAATATAACAATCTCTTCCCC
CATAATTATGCACAGGTAGGGGAAGTAAAACTCACAAAGGGAATGACCAACACCAAAGTGCATACTTAGC
AGGTAGGAGAGACAAATCGGTCTGACTTCAAAGCCTCTGTCTCTAAATACTGTATTTTGGTGGTTTACTG
CAATCACTATAATACTATACACTATGCAGTAATTAAAAGAATATGGCCATTGTCGGAAAGCATGAGCCAT
TTATAAAAGCCATGCTCTTTCAGGTCTCAAGGCTTAGCCAGGGAAAATCAAAGGACTATCAAAACCAATA
ACACAGTGTGTGATTTCCTAAGCTTACTCCATGTGCCTCTATATTAAACCCTTCCCAGGTATTAATTAAT
TAGTCAGTTACCAAAGTCCCGAGACACTTCTCCAGGAGCTGAGCAAAAGTTGAGCCCTGGGCTATTCTAC
TTTCTCCTCCATCCAAATGACCTTGGAGGAACCAAACCATGGGTCCCAGCTTCTTTGTGGTATATATTAT
ATATTAATATTTAATGTATATTTATACTACTATCGCATGCAATGTAACACGATATTATATATAGATTCCT
GCCTTGGAATACATATTTATATAAAACAAAGCTTGGCCTGGCTCTTATTTTAGGTCAACCTAAGTCTTTA
ATGAGTAGGTAAGAGAGACCATGATGGTCACTGGAGATAACCAGATACACACACCAGCCCACCTGAGCAA
ATCTATCAGGTAAGATCATCTGCTCTTCTCCCATTCTAACTGTTCCATTGATGTTGGTTTTTATTCTTCT
CTTCTCTTCTCTTTTTTCTCCACCAGACAAATCAAAATTAAACTTAACTTCACGTTTTAAAGAGCTAATT
CACAAAAGACTCTAAGAAGGCCTAAAGCCTTAGAAATCTCCCTTTCTTAAAGCTTAGACGCACCTATCCT
TAGCCTATGATTATTCAACACCACTCACCATGGCTGTTTCACGGGTGCACTTCATGCTGGTTTCTCCAAT
GGCTGCTTCTTCCCTCAGGAAGTACTTTCTTCTAAGTATGTCTTCCTGGGTATGT
Protein Sequence
>gi|119360346|ref|NP_665855.2| interleukin-17F precursor [Mus musculus]
MKCTRETAMVKSLLLLMLGLAILREVAARKNPKAGVPALQKAGNCPPLEDNTVRVDIRIFNQNQGISVPR
EFQNRSSSPWDYNITRDPHRFPSEIAEAQCRHSGCINAQGQEDSTMNSVAIQQEILVLRREPQGCSNSFR
LEKMLLKVGCTCVKPIVHQAA
Molecule Role Vaximmutor
Related Vaccines(s) MVA/IL-15/5Mtb vaccine
References