VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

Ebi3

Gene Name Ebi3
Sequence Strain (Species/Organism) Mus musculus
NCBI Gene ID 50498
NCBI Protein GI 7657052
Genbank Accession AC154235
Protein Accession NP_056581
Taxonomy ID 10090
Chromosome No 17
Gene Starting Position 55952622
Gene Ending Position 55957021
Gene Strand (Orientation) +
Protein Name Epstein-Barr virus induced gene 3
Protein pI 10.35
Protein Weight 23864.43
Protein Length 228
Protein Note Also known as EBI-3; IL-27; interleukin-27 subunit beta
DNA Sequence
>gi|372099093:55952622-55957021 Mus musculus strain C57BL/6J chromosome 17, GRCm38 C57BL/6J
TGACTTCTCCCTTTTGGGGCCCTCCTTCTACCTCAAGGCCTTTCCCCACACATACACACAGCAGCTGGTG
ACAGAATCAGGGTTCCCGTCACCATCATCATCTCCTGCCCCATACACTGGACAACTGAGCCACACTGGGC
AGGTCCTTCCCTGGGGCCAGGTTCCCTGTGTGAGTCCCCTGTCCTTCACCCTCTCTCTGATGGGTCACTA
ACTCGGATCCAAGGAACAGAGCCACAGAGCATGTCCAAGCTGCTCTTCCTGTCACTTGCCCTCTGGGCCA
GCCGCTCCCCTGGTTACACTGAAACAGGTAGGTGACCACAGGGGGACTGGGGCACCTGGGCGGAGGGAAC
TAGTCCTTCCCTTTCAGTTTAAGGTCATATCTACCATCAGCTGGGAACTCACACCTATACCCGTTGGACC
TGTTCTCCTTCTACTACAGGGATGGGGAAACTGAGGCATGAAGCCTCAAAACCTCATTTATCCAGGCAGA
GGCACCCTTGAACTTAGACATTTGTGGAGCTAGACAGTTGACTCTCAGAAACCCGAAACCTGAAGCCTCA
CCTTTGTGACTCAGCAGCTGTAAAAGAAAAGAAAACGAAAAAGAAATGTAGACAATACTGGGTATAGTGG
GGCACACCTGCCATGAAGCTCTCAGGAGTTCAGGGTCATCCACAGTCACATAGGAGGAAGCCAAGTATCA
AGAGATTCCAATGTCCTGATCCACTCAGGGTAGGAGGCAGCCTAGGCCCCTTGGGAACCTGCTTCTAAAG
CAACAGAACAAGTGTGGGGTGTGGGTAGTCTAGGGAGTTCTTCAGAATCCACAGTTCAAGGCCAGCCTAG
GCTATGTGAGACCCTCCAGAAGGAGGAAGAGGAGGAGGAAGAAGGAAGAGGAGGGAGATGGAGGAGAAGG
AGAAAGGAGAGAAGGGAAATTAGAAAAAAAGAAGAAAAAAAAAAAAAAACCTCAGGCCAGGCAGTGGTGG
CACACGCCTTTAATCCCAGCACTTAGGAGGCAGAGGCAGGTGGATTTCTGAGTTCCAGGCCAGCCTGGTC
TACAGAGTGAATTCCAGGACAGTCAGGGCTACACAGAGAAACCCTGTCTCGAAAAACCAAAAAAAAAAAA
AAACAAAAAAACAAAAAAACCTCAGTTTTCTCATCTAGAAATTGAGCTAAGAACCTTGGGGTTTGTAGTA
AGTATAGGAGCTCATGCTTCCATGCATAACAGGTCCTACATGGCCTACGGAAGCTCCTGTTCCTTTGTCT
CCTCCAGCTCTCGTGGCTCTAAGCCAGCCCAGAGTGCAATGCCATGCTTCTCGGTATCCCGTGGCCGTGG
ACTGCTCCTGGACTCCTCTCCAGGCTCCCAACTCCACCAGATCCACGTCCTTCATTGCCACTTACAGGTC
AGAAAATGGAAAGGGTTTAGGAGGAAGCCAAGTATCAAGAGATTCCAATGTCCTGATCCACTCAGGGTAG
GAGGCAGCCTAGGCCCCTTGGGAACCTGCTTCTAAAGCAACAGAACAAGTGTGGGGTGTGGGTATTCTAG
GGAGTTCTTCAGAATCCACAGTCCCCAAGTCCCCCTGAGCATATCACCCCCTGAGCGTGACCCACAGTCA
GCTGTGGGTGAGCTGGGGCCTCACGGGCACCCAGGTTCCTTTCGAGATTCACCATGGTGCTTCCCATGCA
GGCTCGGTGTGGCCACCCAGCAGCAGAGCCAGCCCTGCCTACAACGGAGCCCCCAGGCCTCCCGATGCAC
CATCCCCGACGTGCACCTGTTCTCCACGGTGCCCTACATGCTAAATGTCACTGCAGTGCACCCAGGCGGC
GCCAGCAGCAGCCTCCTAGCCTTTGTGGCTGAGCGAATCAGTGAGTGTCTGTCCTCCCTGCCCCTCTCCA
CCTGCTCCATCCCGTGGCTCCTCCCTGCCGCCGCCCCCCTACCCCCACCCACCTCTTGCTTTGTCCCTGC
AGCTTCCATCCTTTGGCTCTGCTCCCGCCTCACAGGCTTCCTGTCGATGCCCCGGGGCCTTTGCATTGCT
TCCTTCCTTGGCTTTCCTGGGTCTCTGCTCCAATGTTGGCTCCTCAGTGAGGCCTCCCCAAAAGTATATC
ATTAAACATAAGCAATAGTCACAGTTAAGAGAGGATGAAAGCCAAAGGTGGTGTACAAGTCTTTAATCCC
AGAGGTAGGCAGATCTCTGAGAATTCAAGGCCAGCCTGATCTACAGATCATGTTCAATGCAAGCCAGGGT
CACTCCTGAGCACCTGTCTCAGAAAAGAAAGCCAAGAACAAAAGCTGATGCAGGTCGGTGAAAGGCTACA
CAGCTCTCGAGGGTTTAAACCTGAAGTCTCGACATGATCGCCCAACTCCAATCCTAAGGATCTGCTCAAC
AGCAATAAAGCTGTTCCTCCCTACCAATCCTTGGCAACATCATTGCTGGCATCCAGAAGGCCAGTGCCCC
GTGCGTTCCCATGGAGCGATGGGCACCCAGTGCTTATCTAGCGTTACTCAGCCCTAACAAAGAGAGAGTG
GGGCTCTGGCACCAACAGCTGTGGCGGGACCTTGAGGACACTACGCTCAGTGAGCAACCCAGACTCAACC
CACCCAGTGTGGGCTGCAGTACAGAGGAGTCTAGAGACAGGAAGCCTGAGTGCTGAGGACAGAGAAGGGT
AGGAAGATGGCTTGTGTTGTCATGAAGGAGTGTTCCATAAGTAGGTGGAGTAATGAAAACGCTCTCTGCA
GATGCACGGGATGTCTTCTAGCAGAGACTTGTGCTCTCAGAATTGTATCTCAGAAAAGCCCTTCAGCCTA
CTGGAGACTTGCACTTTTCTTTGCCTGTGCAACCCTTGTGACTTCTATCAGCAGTGATGAGAGCGGTCCA
GCAAATGGTTTTTCCTTGAGCAGATAGACGAATGAAGGAATAAATGAATGCCTGCATGACAGATATCAAG
TGGATGAGTGAATGATTTAGTAATGAATGAATGCATAATGAGTGAATGAAGGCAGAAATGACATGAGTGC
ATGCACACGAATGACTTAATGAATGAACGAATGAATGCATGAATGACTTAGTGAATGAGTGAATAAATGC
ACAACTGACATAATGAATGCATAATGAATACATGAAGGCCATGAGTAAATGAATGAATGACATGAGTGAG
TGCATGAACGAATGAATGACTCAATTAGGGAGTGAATGAATGAATTCACAAAGGATACAGTGAATGACCT
AATGACTGGGAAATGGATCCCTGAACGAATGAGTGTATAAACGATAAGCGCAAATGAATGAGTTAATGAA
TCCAGAAACAAATCTGCACTTGAATCAACCAATAAATAAATGTGTGAGTGAGATGGTGAGTAACTGAGTA
GAGGAATGAATTAGTGAAGAATTTAGTGAATACGTGAACGAATGAAGTGTGAGTATGAATGAACGGCAGG
ACGGAGCAAATCCATGAATAGCTGTCTGAGGGCGAAAGCGAACATGTGAATGAATGAGAGTCACAAACGA
AGACTTAGTGTGTGAGGGATGAACCGGCAGAGCGGACGCTGACCCCGGTCCTGCTCCCACCAGTCAAGCC
GGACCCTCCGGAAGGCGTGCGCCTGCGCACAGCGGGACAGCGCCTGCAGGTGCTCTGGCATCCCCCTGCT
TCCTGGCCCTTCCCGGACATCTTCTCTCTCAAGTACCGACTCCGCTACCGGCGCCGAGGAGCCTCTCACT
TCCGCCAGGTGAGCTGCGCGCGCAGGGGGGCGTGGTCTGGAAGAAGGAGGAGCACAGAGGTGGATGCTGA
GTGAGACTGGGTCCCACTGGGTAATCTCCTGTCTCCGCCTATCGCCTCTGTTGGAGCGTAGAGATTGTTG
GTGTGATTCAGCAATAGACTTTACCTGCTTGCTGGGAATTCGAACTCACTGCAAGCTCTTTACCCACCAA
GCCAGCTCCCCAGCTCCCCAATGCATTGTGGTCCTTCCCACCTCCTCCTTCCAATGGCCTGACACCCCTT
CTCCCCACAGGTGGGACCCATTGAAGCCACGACTTTCACCCTCAGGAACTCGAAACCCCATGCCAAGTAT
TGCATCCAGGTGTCAGCTCAGGACCTCACAGATTATGGGAAACCAAGTGACTGGAGCCTCCCTGGGCAAG
TAGAAAGTGCACCCCATAAGCCCTGAAGAGGGACTGGATCCTTGATATCAGACCCTGATGTCGTCTACTT
GAGGGTGGCAGGGTGGCCTGTCCTGAGTCTGAATACTGACTTTCCATGTACTGGGCTGCTCCGAAGCACT
GGATAATTCACTTGACTTCTTCAGACCTCAATTTCCAACCCTGTGGGATGATCTTTCTTCTTCTGCCGGT
GCGGGGCTTTGTGAACTTTGTGATTTAATTAGAAAGACGGATTAAATAAGAATCATCATC
Protein Sequence
>gi|7657052|ref|NP_056581.1| interleukin-27 subunit beta precursor [Mus musculus]
MSKLLFLSLALWASRSPGYTETALVALSQPRVQCHASRYPVAVDCSWTPLQAPNSTRSTSFIATYRLGVA
TQQQSQPCLQRSPQASRCTIPDVHLFSTVPYMLNVTAVHPGGASSSLLAFVAERIIKPDPPEGVRLRTAG
QRLQVLWHPPASWPFPDIFSLKYRLRYRRRGASHFRQVGPIEATTFTLRNSKPHAKYCIQVSAQDLTDYG
KPSDWSLPGQVESAPHKP
Molecule Role Vaximmutor
Related Vaccines(s) MVA/IL-15/5Mtb vaccine
References