VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

Cxcl11

Gene Name Cxcl11
Sequence Strain (Species/Organism) Mus musculus
NCBI Gene ID 56066
NCBI Protein GI 9507071
Genbank Accession AC122365
Protein Accession NP_062367
Taxonomy ID 10090
Chromosome No 5
Gene Starting Position 92359543
Gene Ending Position 92363295
Gene Strand (Orientation) -
Protein Name transcript variant 2
Protein pI 11.02
Protein Weight 10670.03
Protein Length 100
Protein Note Also known as Ip9; H174; Itac; b-R1; Cxc11; I-tac; Scyb11; Scyb9b; betaR1
DNA Sequence
>gi|372099105:92359543-92363295 Mus musculus strain C57BL/6J chromosome 5, GRCm38 C57BL/6J
CTTTACTTTAAGATAGGGTTTCTCTGTGTAGCCCTGGCTGTCCTGAAACTCCTGGTCTGTAGACCAGGTT
GGCCTTGAACTCAAGAGATCCTCCTGCCTCTGCCTTTCAAGTGCTGAAATTAAGGTGTATACCACCACAC
CTAGGTAATTTTTTTTATTGAAATTTTTAACAGTACCTTTTTATCATATTTTTTTCTCATCTTCAGCTCC
TCCTCACTAAAGTATATTCCTTTCTATTTTAAAATTTTGTGTAGCCCTGACTGTTCTGAAAGACCAGTCT
GGCCTGGACCTCACAGAGATCCGCCTGCCTCTGCCTCCCAAGTGCTGGGATTAAAGGCGTGTATGTTTCT
AAAGAATTCTGACAAAAACTTGTGTAGCTCTAAAAAACAAAACAAAACAAAACAAAATCTAAAGGCATCT
CAATGTCCAGAGAGCATGTAGTTGTTGATGATTTAATAAGTGTTATAATAGCTTACTAGAGAAACACAAT
TCTTATTCTTTTCAAGGAGAGACAGAGCCAGCCATCCCTACCATTCATTCACAGTATGACCAAGGAAAAG
AACAAAGTACATATTTATATATTTTTCTCAAAGGCAGACTCACAGGAAACAGACTGAAAGAGGTGCACAG
ATTTTTTTTTCAACATTTTTCTTTGGTGAACAGAACCAATTTATTTTAAAAATCTATCCTTGTTATTGTC
ACTGATAAAACCAGACGTACAGGAAATACACATCTTAACCCCTTAGAAGGCCTCAGGGGGAAGCCAGTGT
GACTAGCTAGGAAACAAACAGTAGTGTTCTTACTAGTTTCTACAACGCAGAAATGAATCGTAGTCTTTTT
AAATGAACAAACAAGACAAAATGTGGAAATGTCTTCCTAGATGTTCGTGTGCCTCGTGATATTTGGGGAA
AGGAATGTTTATTTGCATGAACAATTCTTTGAGGAATGTTTTACTACACACAGAGATGCTTTTGAATCCA
GCACTGGTCCGGATTGCAGTAACAATGCATCCACTGTAACCACAGAAGGTAGCGTGGAGTGTGCACGTGA
CTTTTAGAGACAAATATTTTTCATAGCCAAGTAGAACAGTTTAGATGTATCGGACCTTCTAGAAAGTTCT
GCAGCCTGGTAATACGTGGCTGCATGTTCCAAGACAGCAGAGGGTCAGGTTCCTGGCACAGAGTTCTTAT
TGGAGGGCTCACAGTCAGACGTTCCCAGGATGTCACATGTTTTGACGCCTTAAAAAATTCTTTTTTTCTA
TTGCCTGTAATGAGAAAATGAAGAGTTTTACTTACTGGGTTGTTTCGTTTCCTCAGTAATTAAGAGCTGA
CCTGTAAAAACAACGCGGAGGGGTAAGGATGTGGCCAGGTTTAACCCAGGACCCCTTAACTGGGTGCTTC
TGTTAGGATGGTAATGGGGTCTTCCGGCAGTCGCCTGTTCTCTGTGTTCCAGCACTCTCGTGGGTAAAGC
ACTTTCCGACCTGGCCGACTGGCAACCTACCTGCATTATGAGGCGAGCTTGCTTGGATCTGGGGTCCAGG
CACCTTTGTCGTTTATGAGCCTTCATAGTAACACTGGTAAGGGAGACACAAAAGAGTCTTAAACTTTGGT
GGGAAAACATCAACCAAACAAAAGCACCCATACCATTGTCACCTCCAGCACATACATCACTTCAACTTTG
TCGCAGCCGTTACTCGGGTAAATTACAGAAGCTTTCTCGATCTCTGCCATTTTGACGGCTTTCATCCCGG
GGCCGATGCAAAGACAGCGCCCCTGTTTGAACATAAGGAAGCCTGGGACAGACCACAGTGTTGGTTAGTC
AGGGCTGTGAAGTGGATGGCAGACGCATTTGTTAATCTCAACTGTGCAGACTGAAATTAAGTTTTTGAAT
CTCTCTGCATTAGGCTAATTTGCTGTATCCTTGATGATTTCCTTCCTTAATTTTTGTTAATTATTTAATT
TAGGTTGCAGACAGGACTCACTTGCTATTTGGACCAGGTTTGCCTCCAACTCACCACAAAGCCCAGGATG
ACCTTGAACTTGAAGCACTCACTACAAAGCAGCCCCCTCCCCCCATCTTGGCATTATCCTACCTCACTCA
GCTCACCCTCCTAAGTGCTGAAGTTATATTACAGTATGAGTATGCTATGAGACCGGCTCTTGATTACTTT
AAATAACACCTACACAGTATACAGCAACCCAGAGAACAAAGTGGCTATTTATTTGGAATTATTTTATGAC
TGGTGGAATGGGTATACAAGCGTCTTTCACAGTCGCTGGTGATCTGTTCTTTACTAAATGAGCAAATAGT
TGATAATTTCTTTGATCTTTGTCTTCCCAGTTCAAATTCTAGATTAAGACTAAGTATTATGAATCATGTT
GTCTCCCACAGCTGAAACTGTCTTTAAAGCTTCCAGATGCTCCCAGGGAAACCTCAAAGGTTCATTATTT
CATAAGAGCAGCAAGAGTTGTAATAATGGCTTGGCTTGTCACATTAACTTCATATCTGGCTTAGCCCAGG
TCTGCTGTGATAATCGTGTAAGAACCATCAGCTCACAGGAGAAACACTTCCAGGTTCAGTCATGGGACAT
GTGAATAATGCTTCTATTTAGAAACAATATTCTTTGGGAAGAGCTTGTGGAGCATTGTCAGTATCCACAC
TACCTTTAAGTCACTCTTGCCCTCAAGTGACATATTGATCAAGCACGTATGACATTTTTATGACCATTGC
CCCAGAGAGAAATTTCCTTTTCTCTATTCTGAAAGTATTGGTCATAACAAATTAGCAGTCTCCTGGTTAA
AACATTAATTTTTTCAGAATACCAGCATAATCCCACATAAGATTCTCTGAACAGGCATTGAGGACTGGAT
AATTGTCAGAAAATGAAGAAATTGGGCAGGGGTGGCGCACGCCTTTAATCCCAGTACTAACAACTGTGGA
GGAATACAATGGCATTGTTTACTGCCTAATATTTGTAAGTTGCTCTGACCATAATATCTGTGGTTTATTT
GAAATACAAATCGCCAGGTGTGGTGGTGCACGCCTTTTATCCCAGCACTTGGGAGGCAGAGGCAGGCGGA
TTTCTGAGTTTGAGGCCAGCCTGGTCTACAGAGTGAGTTCCAGGACAGCCAGGGCTACACAGAGAAACCC
TGTCTTGAAAAAAACCAAGAAAGAAAGAAAGAGAGAAAGAGAGAAAGAGAGAAAGAGAGGAAGAGAGGAA
GAGAGGAAGAGAGAGAGAAAGAGAGAAAGAAAGAGAGAGAGAGAGAAAGAAAGAAAGAAAGAAAGAAAGA
AAGAAAGAAAGAAAGAAAGGAAGGAAGGAAGGAAGGAAGAAGGAAAGAAAGAAAATGAATCCATAAACTG
ATCATTTTCTTTAAGGATTTCCAACATTTGCTGCGCCATTGCTAGAACTTCTTTTTTTAATTATTTATTT
TTTATTAGATATTTTCTTTATATACATTTCAAATGCTATCCCGAAAGTTCCCTATACCCTCCCCTTAGAA
CTTCTAATATGTGAAATAAAGTAAATTTTTAAAACTGTATATTTTAGAGAAAAAGATATTTGAAAAGTAA
CACAAGGAACAGACAGACTCAGAAGCTACGGGCACCAAATACCTTGAGCAGCTGTGGCCCAGATATTGCA
GCCAGGGCTATGGCTGTGACCTTCCTGTTCATCTCAGCAGCCGCTGCAGCTCTCTGCCTGGGCTTTGGAG
ATCTCTCTTTGCAGAGAGCAACGGCAGGCAGGAAGGCTGAACC
Protein Sequence
>gi|9507071|ref|NP_062367.1| C-X-C motif chemokine 11 precursor [Mus musculus]
MNRKVTAIALAAIIWATAAQGFLMFKQGRCLCIGPGMKAVKMAEIEKASVIYPSNGCDKVEVIVTMKAHK
RQRCLDPRSKQARLIMQAIEKKNFLRRQNM
Molecule Role Vaximmutor
Related Vaccines(s) MVA/IL-15/5Mtb vaccine
References