VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

vjbR

Gene Name vjbR
Sequence Strain (Species/Organism) Brucella abortus S19
NCBI Gene ID 6326704
NCBI Protein GI 189022339
Locus Tag BAbS19_II01090
Genbank Accession CP000888
Protein Accession YP_001932080
Taxonomy ID 430066
Chromosome No 2
Gene Starting Position 117845
Gene Ending Position 118624
Gene Strand (Orientation) +
Protein Name LuxR family regulatory protein; VjbR
Protein pI 6.76
Protein Weight 26640
Protein Length 259
DNA Sequence
>gi|189022234:117845-118624 Brucella abortus S19 chromosome 2, complete sequence
AATGAGTCTTGATCTCGTTCATTTTCCGAATTACAAAAAAACCTTTTTTGGTTCTTCCTTTCAAAGCGAT
ACTTTGGCGCTTCTAACCCGCATCCGGGATGAAATAGGATGCCGCTACGTAACGCATACCTATCGTGGTC
GCGTAGGCGACTGCACGAAGGTGAATTCAGCCGATCTGACTGTTCTTATGACGCTGCCTGCTACCTGGGT
CGCGCGCTATTCCTCGAAAAACTACTTTGCCATTGACCCGGTTTTTCAGGAAGACGCTCCGTATTACCGC
AATGATACGAGCGCCATTGCCCGCGACCTGAAAGAAGATGCGGATATTTGCCCGGCCGTTGCCGAACTGT
TGCATGATGCTGAAAAGCACGGCCTGGGAAATCTTTTCATCGCCGTATCCGCGCGCAATCCCAAGGGCGT
TGCGGGTTGTACGGTTTTCACTTTCGAGGTGGAGGACGAAGACCGTACGCAATTCCTTGCCAGGATGCGC
CCGCGCCTTCTAAGCCTTGCCGGCATCATTCATGGAACTGTCTGCGGCTGCAAGGATGCAAATTCAGTTG
CAAGCCTTCTCACCCCGCGCGAGGTCGATTGCCTGCGCTGGGCTGCCAATGGCAAGACTGATGGCGAAAT
CGCCGAAATCCTCAGCATCGCCCGCTGGACGGTGGTGACTTATCTACAGAATGCCAAAATCAAGCTGAAC
TGTTCCAATCGAACGTCGGCAGTGGCGACGGCGCTTTCCCTCGGCATTATCGATATGCCCGAGGTACAGC
ATCTCGTCTG
Protein Sequence
>gi|189022339|ref|YP_001932080.1| LuxR family regulatory protein [Brucella abortus S19]
MSLDLVHFPNYKKTFFGSSFQSDTLALLTRIRDEIGCRYVTHTYRGRVGDCTKVNSADLTVLMTLPATWV
ARYSSKNYFAIDPVFQEDAPYYRNDTSAIARDLKEDADICPAVAELLHDAEKHGLGNLFIAVSARNPKGV
AGCTVFTFEVEDEDRTQFLARMRPRLLSLAGIIHGTVCGCKDANSVASLLTPREVDCLRWAANGKTDGEI
AEILSIARWTVVTYLQNAKIKLNCSNRTSAVATALSLGIIDMPEVQHLV
Molecule Role Virmugen
Molecule Role Annotation A vjbR mutant is attenuated in BALB/c mice and induces significant protection against wild type challenge (Arenas-Gamboa et al., 2009).
Related Vaccines(s) Brucella abortus S19 vjbR mutant vaccine
References