VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

Pol SIV

Gene Name Pol SIV
Sequence Strain (Species/Organism) Simian immunodeficiency virus SIV-mnd 2
NCBI Gene ID 956107
NCBI Protein GI 27311168
Locus Tag Siv2gp2
Genbank Accession AF367411
Protein Accession NP_758887
Taxonomy ID 159122
Gene Starting Position 2049
Gene Ending Position 5081
Gene Strand (Orientation) +
Protein Name pol protein
Protein pI 7.91
Protein Weight 106929.88
Protein Length 1010
DNA Sequence
>gi|27311166:2049-5081 Simian immunodeficiency virus SIV-mnd 2, complete genome
ATTTTTTAGGGAATACCCCCTGGGGCAGTGGCAAACCCAGGAACTTCCCGGCGATGCCATTGACCCCAAC
GGCCCCTCCAATGCCAGGGATGGAAGACCCAGCAGAGAGAATGCTGTTAGATTACATGAAGAAAGGGCAA
CAGCAGAAAGCGGAAAGCAAACAGGAAAAGAAAGAGAGGGGTCCATACGAGGCAGCTTACAACTCCCTCA
GTTCTCTCTTTGGAACAGACCAACTACAGTAGTAGAGATAGAAGGGCAAAAAGTGGAGGCCTTACTGGAC
ACAGGAGCTGATGATACAGTAATCAAAGATCTAGATTTAAAAGGTAATTGGAAACCACAGATTATTGGAG
GAATTGGAGGATCAATCAATGTAAAACAGTTTTTCAATTGTAAAGTAACAATAGCAGGCAAAACTACACA
CGCTTCAGTCCTAGTGGGCCCCACACCTGTAAATATTGTAGGTAGAAATGTGCTGAAGAAATTAGGATGT
ACACTAAATTTTCCAGTTAGTAAAGTAGAAACAGTAAAGGTAACACTAAAACCAGGAACTGACGGACCTA
AAATAAAACAATGGCCATTGTCTAAGGAAAAGATTTTAGCCTTACAAGAAATATGTAGTCAAATGGAGAA
GGAAGGCCAGATCTCTAAGATAGGTCCAGAAAATCCTTACAACACACCGGTGTTTTGCATCAAAAAGAAA
GATGGAACCAGCTGGAGAAAATTGGTAGATTTTAGACAGTTAAACAAAGTAACTCAGGACTTCTTTGAGG
TGCAGTTGGGAATCCCACACCCTGGAGGTCTCAAACAATGTGAGCAAATTACAGTACTGGACATAGGGGA
TGCCTATTTCTCATGTCCTTTGGATGAGGACTTTAGAAAGTACACTGCATTCACCATTCCATCGGTGAAT
AATCAGGGCCCAGGAATCAGGTACCAGTATAATGTCCTACCACAGGGATGGAAGGGCTCCCCAGCCATTT
TCCAGGCAACAGCAGATAAAATCTTACAGCCCTTCAGAGAGAGACATCCAGATGTAGTGATCTATCAATA
TATGGATGATCTCTTTGTTGGGAGTGATAGAGTTGCCCCAGAACACAGCAGAATGATTCAAGAGTTAAGA
GACCACCTCTTGTTTTGGGGGCTCGAGACCCCAGACAAGAAGTTTCAAAAGGAACCACCCTTTGAGTGGA
TGGGATACATACTGCACCCTAAGAAATGGACAGTGCAGAAAGTACAGCTTCCAGAGAAAGAAGAATGGAC
AGTAAATGACATCCAAAAGTTGGTAGGGAAACTTAATTGGGCAAGTCAGATTTATTCCGGAATTAAAACA
AAAGAGCTCTGTAGACTAATTAGAGGGGCAAAACCCCTAGATGAAAAAGTAGAATGGACTAGAGAAGCAG
AATTAGAATATGAAGAAAACAAACTCATAGTGCAGGAGGAAGTGCATGGAGTATACTATCAACCAGAGAA
GCCTTTAATGGCAAAGGTTCAAAAATTGACACAAGGGCAATGGAGTTACCAAATAGAGCAGGAGGATAAT
AAGCCGCTGAAGGTAGGGAAATATGCCAGAACAAAGAATGCTCATACAAATGAGCTTAGAGTGCTTGCAG
GACTAGTACAGAAGATTGCAAAAGAAGCTTTAGTGATCTGGGGAAAACTCCCTAAGTTTTATCTGCCAAT
AGAAAGAGAAGTCTGGGACCAGTGGTGGCCAGAATATTGGCAAGCCACATGGATTCCCGAATGGGAATTT
GTATCCACTCCACACCTTATCGGGTTGTGGTATAACCTGTTGAGAGAACCTGTGCCAGGAGAAGATGTGT
ATTATGTGGATGGAGCAGCTAACAGAAACTCCAAAGAAGGGAAAGCAGGATATGTAACAGCTAGAAATAA
ATCCAGAGTAATAGCCCTAGAGAATACCACAAACCAAAAAGCAGAATTGGAGGCAATAAAAATGGCATTA
CAAGACTCAGGACCAAAAGTAAATATAGTGACAGATTCACAGTATGCTATGGGTATCCTATCGGCAGCAC
CCGACCAATCAGACAACCCCATAGTAAGAGAAATTATAGAACTCATGATCCACAAGGAAGCAGTATACCT
AGCTTGGGTACCAGCACACAAAGGCATAGGAGGGAATGAGCAAGTAGATAAACTAGTGAGCAGAGGAGTA
AGGCAAGTACTGTTTTTAGAAGGCATAGATAAAGCACAAGAAGAGCATGATAAATATCACAATAATTGGA
GGGCATTAGCACAAGACTTCTGTATACCAAACATAGTGGCAAAAGAAATAGTAGCCCAGTGTCCAAAGTG
TCAAACAAAAGGAGAGCCAATACATGGCCAGGTAGATACATCCCCAGGAACCTGGCAAATGGACTGCACA
CATATGGAAGGAAAAGTAATCATAGCAGCAGTCCATGTAGCAAGTAGGTATCTAGAAGCAGAAGTAATAC
CCACAGAAACAGGAAAAGAAACAGCACACTTCCTGTTAAAATTAGCAGGTAGATGGCCAGTAAAACATCT
ACACACAGATAATGGCCCTAATTTCACCAGTGAAAAAGTAGCCACAGTCTGTTGGTGGGCTCAAATAGAG
CACACTACAGGAATTCCCTACAATCCTCAGAGTCAAGGAGTAATAGAGGCAAAAAACCATCATCTCAAAC
AAATCATAGGGCAAGTTAGAGACCAAGCAGAGAAACTAGAAACAGCAGTTCAAATGGCAGTATTAATTCA
CAATTTTAAAAGAAAAGGGGGGATAGGGGAATACAGTCCAGGAGAAAGAATAGTAGACATTATAGCAACA
GACCTCCTAACAACTAAATTACAACACAATATTCAAAAAATTCAAAATTTTCGGGTTTATTACAGAGAAG
GAAGGGACCAACAGTGGAAAGGACCAGCAGAACTCATTTGGAAAGGAGAAGGAGCGGTGGTAATCAAAGA
GGGGACAGACTTGAAGGTAGTACCAAGGAGAAAAGCAAAAATCATCAGAGATTATGGAAAAACAGTGGAT
AGTGATCCCAACGTGGAAGCTTG
Protein Sequence
>gi|27311168|ref|NP_758887.1| pol protein [Simian immunodeficiency virus SIV-mnd 2]
FFREYPLGQWQTQELPGDAIDPNGPSNARDGRPSRENAVRLHEERATAESGKQTGKEREGSIRGSLQLPQ
FSLWNRPTTVVEIEGQKVEALLDTGADDTVIKDLDLKGNWKPQIIGGIGGSINVKQFFNCKVTIAGKTTH
ASVLVGPTPVNIVGRNVLKKLGCTLNFPVSKVETVKVTLKPGTDGPKIKQWPLSKEKILALQEICSQMEK
EGQISKIGPENPYNTPVFCIKKKDGTSWRKLVDFRQLNKVTQDFFEVQLGIPHPGGLKQCEQITVLDIGD
AYFSCPLDEDFRKYTAFTIPSVNNQGPGIRYQYNVLPQGWKGSPAIFQATADKILQPFRERHPDVVIYQY
MDDLFVGSDRVAPEHSRMIQELRDHLLFWGLETPDKKFQKEPPFEWMGYILHPKKWTVQKVQLPEKEEWT
VNDIQKLVGKLNWASQIYSGIKTKELCRLIRGAKPLDEKVEWTREAELEYEENKLIVQEEVHGVYYQPEK
PLMAKVQKLTQGQWSYQIEQEDNKPLKVGKYARTKNAHTNELRVLAGLVQKIAKEALVIWGKLPKFYLPI
EREVWDQWWPEYWQATWIPEWEFVSTPHLIGLWYNLLREPVPGEDVYYVDGAANRNSKEGKAGYVTARNK
SRVIALENTTNQKAELEAIKMALQDSGPKVNIVTDSQYAMGILSAAPDQSDNPIVREIIELMIHKEAVYL
AWVPAHKGIGGNEQVDKLVSRGVRQVLFLEGIDKAQEEHDKYHNNWRALAQDFCIPNIVAKEIVAQCPKC
QTKGEPIHGQVDTSPGTWQMDCTHMEGKVIIAAVHVASRYLEAEVIPTETGKETAHFLLKLAGRWPVKHL
HTDNGPNFTSEKVATVCWWAQIEHTTGIPYNPQSQGVIEAKNHHLKQIIGQVRDQAEKLETAVQMAVLIH
NFKRKGGIGEYSPGERIVDIIATDLLTTKLQHNIQKIQNFRVYYREGRDQQWKGPAELIWKGEGAVVIKE
GTDLKVVPRRKAKIIRDYGKTVDSDPNVEA
Molecule Role Other
Related Vaccines(s) HIV DNA vaccine pHIS-SHIV-B , HIV DNA vaccine SIVmac239 Gag-Pol-Nef and mock Env with rAd5 boost , rMVTT-SIV-gpe
References