VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

Nef SIV

Gene Name Nef SIV
Sequence Strain (Species/Organism) Simian immunodeficiency virus
NCBI Gene ID 1490008
NCBI Protein GI 9627209
Locus Tag SIVgp7
Genbank Accession M66437
Protein Accession NP_054373
Taxonomy ID 11723
Gene Starting Position 8599
Gene Ending Position 9270
Gene Strand (Orientation) ?
Protein Name nef protein
Protein pI 6.4
Protein Weight 24504.09
Protein Length 223
DNA Sequence
>gi|9627204:8599-9270 Simian immunodeficiency virus, complete genome
TATGGGCTCCAGCAACTCCAAGAGGCAGCAACAGGGCTTGCTCAAGCTCTGGCGAGGGCTGCGAGGGAAG
CCTGGGGCAGACTGGGTGCTATTGTCCGATCCGCTTATCGGGCAGTCATCAACAGTCCAAGAAGAGTGCG
GCAAGGCCTTGAAAAAGTCCTGGGGTAAAGGTAAAATGACTCCAGACGGCCGCCGCCTGCAAGAAGGAGA
CACCTTTGATGAGTGGGATGATGATGAAGAAGAAGTAGGCTTCCCTGTGCAACCTCGAGTCCCCTTAAGA
CAGATGACCTATAAATTAGCAGTGGACTTTTCCCACTTTTTAAAATCAAAGGGGGGACTGGATGGGATAT
ATTACTCTGAAAGAAGAGAAAAGATCCTGAATTTGTATGCCTTGAACGAGTGGGGAATAATAGATGATTG
GCAAGCTTACTCACCAGGCCCGGGGATAAGGTACCCGAGAGTCTTTGGCTTCTGCTTTAAGCTAGTCCCA
GTGGACCTGCATGAGGAGGCACGCAACTGTGAGAGACACTGTCTGATGCATCCAGCACAGATGGGGGAAG
ATCCTGATGGAATAGATCATGGAGAAGTCTTGGTCTGGAAGTTTGACCCGAAGTTGGCGGTGGAGTACCG
CCCGGACATGTTTAAGGACATGCACGAACATGCAAAGCGCTA
Protein Sequence
>gi|9627209|ref|NP_054373.1| nef protein [Simian immunodeficiency virus]
MGSSNSKRQQQGLLKLWRGLRGKPGADWVLLSDPLIGQSSTVQEECGKALKKSWGKGKMTPDGRRLQEGD
TFDEWDDDEEEVGFPVQPRVPLRQMTYKLAVDFSHFLKSKGGLDGIYYSERREKILNLYALNEWGIIDDW
QAYSPGPGIRYPRVFGFCFKLVPVDLHEEARNCERHCLMHPAQMGEDPDGIDHGEVLVWKFDPKLAVEYR
PDMFKDMHEHAKR
Molecule Role Other
Related Vaccines(s) HIV DNA vaccine SIVmac239 Gag-Pol-Nef and mock Env with rAd5 boost
References