VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

Il4 (interleukin 4)

Gene Name Il4 (interleukin 4)
Sequence Strain (Species/Organism) Mus musculus
NCBI Gene ID 16189
NCBI Protein GI 10946584
Locus Tag RP23-188H3.4
Genbank Accession NM_021283.1
Protein Accession NM_021283.1
Taxonomy ID 10090
Gene Strand (Orientation) ?
Protein Name IL-4, Interleukin 4
DNA Sequence
>gi|10946583|ref|NM_021283.1| Mus musculus interleukin 4 (Il4), mRNA
GGATCCCCGGGCAGAGCTGGGGGGGGATTTGTTAGCATCTCTTGATAAACTTAATTGTCTCTCGTCACTG
ACGGCACAGAGCTATTGATGGGTCTCAACCCCCAGCTAGTTGTCATCCTGCTCTTCTTTCTCGAATGTAC
CAGGAGCCATATCCACGGATGCGACAAAAATCACTTGAGAGAGATCATCGGCATTTTGAACGAGGTCACA
GGAGAAGGGACGCCATGCACGGAGATGGATGTGCCAAACGTCCTCACAGCAACGAAGAACACCACAGAGA
GTGAGCTCGTCTGTAGGGCTTCCAAGGTGCTTCGCATATTTTATTTAAAACATGGGAAAACTCCATGCTT
GAAGAAGAACTCTAGTGTTCTCATGGAGCTGCAGAGACTCTTTCGGGCTTTTCGATGCCTGGATTCATCG
ATAAGCTGCACCATGAATGAGTCCAAGTCCACATCACTGAAAGACTTCCTGGAAAGCCTAAAGAGCATCA
TGCAAATGGATTACTCGTAGTACTGAGCCACCATGCTTTAACTTATGAATTTTTAATGGTTTTATTTTAA
TATTTATATATTTATAATTCATAAAATAAAATATTTGTATAATGT
Protein Sequence
>gi|10946584|ref|NP_067258.1| interleukin 4 [Mus musculus]
MGLNPQLVVILLFFLECTRSHIHGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCR
ASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS
Molecule Role Vaximmutor
Molecule Role Annotation IL-4 plays an important role in Th2 immune response.
Related Vaccines(s) B. abortus DNA vaccine pcDNA-SOD , Brucella recombinant SurA protein vaccine , Dobrava-Belgrade virus S nucleocapsid protein vaccine , LVS , Mycobacterium tuberculosis fadD26 mutant vaccine , Mycobacterium tuberculosis mce-2 mutant vaccine , Mycobacterium tuberculosis mce-3 mutant vaccine , Mycobacterium tuberculosis sigE mutant vaccine , Pseudorabies Subunit gB Protein Vaccine , Staphylococcus aureus aroA mutant vaccine
References