VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

vpu

Gene Name vpu
Sequence Strain (Species/Organism) Human immunodeficiency virus 1
NCBI Gene ID 155945
NCBI Protein GI 9629366
Locus Tag HIV1gp7
Genbank Accession AF033819
Protein Accession NP_057855
Taxonomy ID 11676
Gene Starting Position 5607
Gene Ending Position 5855
Gene Strand (Orientation) +
Protein Name Vpu
Protein pI 4.43
Protein Weight 8250.01
Protein Length 82
Protein Note Vpu and gp160 are translated from different reading frames of the same bicistronic mRNA
DNA Sequence
>gi|9629357:5607-5855 Human immunodeficiency virus 1, complete genome
AATGCAACCTATACCAATAGTAGCAATAGTAGCATTAGTAGTAGCAATAATAATAGCAATAGTTGTGTGG
TCCATAGTAATCATAGAATATAGGAAAATATTAAGACAAAGAAAAATAGACAGGTTAATTGATAGACTAA
TAGAAAGAGCAGAAGACAGTGGCAATGAGAGTGAAGGAGAAATATCAGCACTTGTGGAGATGGGGGTGGA
GATGGGGCACCATGCTCCTTGGGATGTTGATGATCTGTA
Protein Sequence
>gi|9629366|ref|NP_057855.1| Vpu [Human immunodeficiency virus 1]
MQPIPIVAIVALVVAIIIAIVVWSIVIIEYRKILRQRKIDRLIDRLIERAEDSGNESEGEISALVEMGVE
MGHHAPWDVDDL
Molecule Role Other
Related Vaccines(s) HIV DNA vaccine pHIS-SHIV-B , HIV DNA vaccine SHIV-89.6 DNA (DNA/89.6)
References