VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

Core protein

Gene Name Core protein
Sequence Strain (Species/Organism) Hepatitis C virus
NCBI Protein GI 349623451
Other Database IDs CDD:144947
Taxonomy ID 11103
Gene Strand (Orientation) ?
Protein Name core
Protein Length 114
Protein Note Hepatitis C virus capsid protein; pfam01543
Protein Sequence
>gi|349623451|gb|AEQ03276.1| core [Hepatitis C virus]
MSTLPKPQRKTKRNTIRRPQDVKFPGGGQIVGGVYVLPRRGPRLGVRATRKTSERSQPRGRRQPIPKARR
SEGRSWAQPGYPWPLYGNEGCGWAGWLLSPRGSRPSWGPNDPRR
Molecule Role Other
References