VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

capsule biosynthesis protein

Gene Name capsule biosynthesis protein
Sequence Strain (Species/Organism) Bacillus anthracis
NCBI Protein GI WP_000409765
Other Database IDs CDD:311953
CDD:332959
CDD:282847
CDD:99910
Taxonomy ID 86661
Gene Strand (Orientation) ?
Protein Name capsule synthesis positive regulator AcpB
Protein pI 8.69
Protein Weight 56188.45
Protein Length 586
Protein Note M protein trans-acting positive regulator (MGA) HTH domain; pfam08280
Protein Sequence
>WP_000409765.1 MULTISPECIES: capsule synthesis positive regulator AcpB [Bacillus cereus group]
MEKDIKRQIQILEIITSEEKWFTTIEISKILRCCNKTIMKDISFIKDFLPEDWHIKIKKGKGVRIYLPYN
KHRNEITFLLFRESLTFRILQHLFERETKTIATLAERLYIQVPSILPALKRVENYLKKFGLKLRKKPLRL
EGDEVRIMIMYLDLYLKSYNDTEWPFEKLKKEVIFQYLGTLEESLGISLHVVSKRHLSFFIAILLKRKQQ
GYKVQLNRKFLYFNTETPDYVKIGRIFEKLEREFGVSLTVQDKILLTISIKSSKYVYKDINKEKEESVQY
FKEGNLSIYELVKDFINSLEEKLKVDLISDEEFIFALVDYFKRTIYHLQYLCMFERPQKQTIQYMQTEHS
ETFSAVKEVYTEFVKKNEIADYVSVEEIAKVTMYIEASRLRYTSNYKKVLLVTGESESWAEYLAATLAKR
FGDKIQISTVFFAKKSDHDVNADFIISTIPLDLGSTPIICINSIPTERDYTNIQYYLDLQDG
Molecule Role Other
References