VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

GM-CSF

Gene Name GM-CSF
Sequence Strain (Species/Organism) Mus musculus
NCBI Gene ID 12981
NCBI Protein GI 110625658
Locus Tag RP23-309E16.1
Genbank Accession AL596103
Protein Accession NP_034099
Taxonomy ID 10090
Chromosome No 11
Gene Starting Position 54247269
Gene Ending Position 54249898
Gene Strand (Orientation) -
Protein Name transcript variant X1
Protein pI 5.91
Protein Weight 15098.22
Protein Length 141
Protein Note Also known as Csfgm; GMCSF; Gm-CSf; MGI-IGM
DNA Sequence
>NC_000077.6:54247269-54249898 Mus musculus strain C57BL/6J chromosome 11, GRCm38.p4 C57BL/6J
CAAAAGTTTTAATAATTTATTATTCTGGTAAGACATTCTCAATAAATAGAGTTGCAAAAATAAATAAATA
AATAAATAAATATTTAAAAAATATAAATATATAAATAAATATAATGGTCCCTATCAGTAGAAAATATCTC
TCGTTTGTCTTCCGCTGTCCAAGCTGAGTCAGCGTTTTCAGAGGGCTATACTGCCTTCCAACTGTGGCTG
TGCCACATCTCTTGGTCCCTTTAAGGCAGAAATTCCAAGTTCCTGGCTCATTACGCAGGCACAAAAGCAG
CAGTCTGAGAAGCTGGATTCAGAGCTGGCCTGGGCTTCCTCATTTTTGGCCTGGTTTTTTGCATTCAAAG
GGGATATCAGTCAGAAAGGTTTTAAGGCTGTCTATGAAATCCGCATAGGTGGTAACTTGTGTTTCACAGT
CCGTTTCCTGGAGGGAATGGAAAAAAATAAACAGCACTTGAGTCCAGGTAAGTGGGCCACGTGGGGAAAG
AACTGTGTATTTCTCTCTCGCTGCTGAGAACTCAGAGGCCAGAAGCCCATTTGTAAGGATCAGGTGACAC
TATAGCTGCCCGTGTGCTGCCTAAGGCATGCACAGCTCTGCCAATGGCACCCAGGGACTGTGCCCTTACA
GAAGGACTGTCTCAGGTCTGCCTCTTTGGTTCCCACCGAGAAGCAAGCAACCAGCCTGAGGCATCTCCTC
ACCTCTAAAAAGACACAAGGCTCACTGTCTTTGATGAGGAAAGGAAATAGGAATGTTTGGGGTGTCTGCC
CATTCTAGGAGCCTCCTCCTTGTATCCATGGAATACAGGCATCCTTACAGGAAAGTCCTGCCAGGAAGTG
GCATCTGGGTGCTGGCTCTTGGCTCTCCTGGGCTTGGGCAGGCCCTGAGCTTCCTTGGGTTTGCCTCACC
TCTGACCTCATGACTGACAATGGCATGTGTGACATGGGCAGATGGTTCCTCCTAGGAAGAGCAGTGGGCT
CTCTGCTGTTTCTCAGCTTAGGGTCTAGGGATGAATAGGAGCTATGGCCTGTTCTTGGGGGGCTCCTAGG
AAACATCTAACAATACAGAAACCACTTACTGGGGCCCTGAACAGCTACAGCCAGAAGTCTCTCCTTACTG
GCCGCACCCTCCCAGACTAAGACCTGGGGCCCTGATGCTGTGTACTCACCGGAGTTGGGGGGCAGTATGT
CTGGTAGTAGCTGGCTGTCATGTTCAAGGCGCCCTTGAGTTTGGTGAAATTGCCCCGTAGACCCTGCTCG
AATATCTTCAGGCGGGTCTGCACACATGTTAGCTTCTGTGGGAAGCATCCATTTGTTGATAAGCAAAAGC
CAAGTGTCCATAGAATACAAGCTAACTTCTCCCTACTCCCTTCTGCTCCCACCAAGTGGTACAGGTTGGG
GCTAGTCATAACACTGTCCTGAGCACTGCCCTTCTTCTTGCCTGGTCCAGGCCACCTCAGCTACCACAGC
CATGTTTATAGTCTGGTACCATAGAGGTTCCCAGTTCCAAGTGCTGTCCCCCCCCCAAAAAAAAAATTTG
TAAGCAAAGGCTACTTGCTGCCATTCTAGAAGAAGGAGATGGCCAGAGCCCAAACTTCTGTGTGGGGAAG
CACTATTTCAAAAGCCCCTCTGTGCCCTGTATAATCAATACCCTCTGTGCCCCTGTATAATCAATACCTT
CTCTCCATGGTCACGGGGCACAGAGAGAACTTGAAGGCAACAAGGCCAACTCATAAAGTGACTCTCATGC
TCCCATCAATCCCTGAAGACCTCTGACCTTTGAAAGCTAGCTCTGCCCAAACTTATTGCTCACTTGATAA
AAAGAGTGCACATGACTGCCACAGGGGCATGGCTCTGGACGATAAAAGAGTGCACGTGACTGCTACAGAG
GAATGGATATAGAGATCTTGACTACCCAGATTCTGCCCCCTCCCGCTGGCAGCCACTGGCAGGGAAGAGT
GTAGAAAGCCTTGCAAGAGGCTATTTAAAGCAGCCCTGCAGGGCAACCCGGGAAGCTACACCAAAAGAGA
AGAGCAAAAGAGAAGCAGCTTACCTTGAAGGAGAACTCGTTAGAGACGACTTCTACCTCTTCATTCTGTA
AAAAGGAAGTGCCGTGTTACCAAGCTGAAAGGCAGGGCAAGACAAGGGCCAATGGGTGGCCTGGGAACAA
CCCAACTCTCTCCCTCACTCACCAACGTGACAGGCATGTCATCCAGGAGGTTCAGGGCTTCTTTGATGGC
CTCTACATGCTTCCAAGGCCGGGTGACAGTGATGGGTGAGCGGGTGGGTGCTGAGAGGCTGTAGACCACA
ATGCCCAGGAAAAGTAAATTCTGCAGCCACATCCTCCTCAGGACCTTAGCCTTTCTCTCTGAGTACTGGG
CTCACTGCAAAAGAGCTCTTATATACACAGTTAGAGGAAATGATTAATGGTGACCACAGAACTCCAGGGG
GGCGGGGGAACTACCTGAGTTGTGGAATCTCCTGGCCCTTATCAGCTATACATGGGGCCAGTGAGCCTTC
CCCCAGGTTGTCAGGCTTGGGGGGTTTTCATTAATAAGCCCTTCCAAGAACTGGCAGCCCACCTGCGGGC
TGCTTTAAAGGCCTTTCCCACCCTGCCTGGGCAGTCTGAC

Protein Sequence
>NP_034099.2 granulocyte-macrophage colony-stimulating factor precursor [Mus musculus]
MWLQNLLFLGIVVYSLSAPTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQ
TRLKIFEQGLRGNFTKLKGALNMTASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPGQ
K

Molecule Role Protective antigen
Related Vaccines(s) Melanoma DNA vaccine pN4a-MAGE-1-GM , Melanoma DNA vaccine pNL3-MAGE-1-GM
References