VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

A33R

Gene Name A33R
Sequence Strain (Species/Organism) Vaccinia virus
NCBI Gene ID 3707686
NCBI Protein GI 66275953
Locus Tag VACWR156
Genbank Accession AF226618
Protein Accession YP_233038
Taxonomy ID 10245
Gene Starting Position 143330
Gene Ending Position 143887
Gene Strand (Orientation) +
Protein Name EEV membrane phosphoglycoprotein
Protein pI 5.23
Protein Weight 19215.93
Protein Length 185
Protein Note similar to VACCP-A33R; associates with A36R; involved in CEV-cell adherence and actin tail formation
DNA Sequence
>NC_006998.1:143330-143887 Vaccinia virus, complete genome
CATGATGACACCAGAAAACGACGAAGAGCAGACATCTGTGTTCTCCGCTACTGTTTACGGAGACAAAATT
CAAGGAAAGAATAAACGCAAACGCGTGATTGGTCTATGTATTAGAATATCTATGGTTATTTCACTACTAT
CTATGATTACCATGTCCGCGTTTCTCATAGTGCGCCTAAATCAATGCATGTCTGCTAACGAGGCTGCTAT
TACTGACGCCGCTGTTGCCGTTGCTGCTGCATCATCTACTCATAGAAAGGTTGCGTCTAGCACTACACAA
TATGATCACAAAGAAAGCTGTAATGGTTTATATTACCAGGGTTCTTGTTATATATTACATTCAGACTACC
AGTTATTCTCGGATGCTAAAGCAAATTGCACTGCGGAATCATCAACACTACCCAATAAATCCGATGTCTT
GATTACCTGGCTCATTGATTATGTTGAGGATACATGGGGATCTGATGGTAATCCAATTACAAAAACTACA
TCCGATTATCAAGATTCTGATGTATCACAAGAAGTTAGAAAGTATTTTTGTGTTAAAACAATGAACTA

Protein Sequence
>YP_233038.1 EEV membrane phosphoglycoprotein [Vaccinia virus]
MMTPENDEEQTSVFSATVYGDKIQGKNKRKRVIGLCIRISMVISLLSMITMSAFLIVRLNQCMSANEAAI
TDAAVAVAAASSTHRKVASSTTQYDHKESCNGLYYQGSCYILHSDYQLFSDAKANCTAESSTLPNKSDVL
ITWLIDYVEDTWGSDGNPITKTTSDYQDSDVSQEVRKYFCVKTMN

Molecule Role Protective antigen
Related Vaccines(s) Vaccinia virus DNA vaccine A33R from strain IHD-J
References