VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

A27L

Gene Name A27L
Sequence Strain (Species/Organism) Vaccinia virus
NCBI Gene ID 3707680
NCBI Protein GI 66275947
Locus Tag VACWR150
Genbank Accession AY160184
Protein Accession YP_233032
Taxonomy ID 10245
Gene Starting Position 140012
Gene Ending Position 140344
Gene Strand (Orientation) -
Protein Name IMV surface protein
Protein pI 5.33
Protein Weight 12174.92
Protein Length 110
Protein Note similar to VACCP-A27L; roles in IMV-cell attachment, fusion, and microtubule transport
DNA Sequence
>NC_006998.1:140012-140344 Vaccinia virus, complete genome
GTTACTCATATGGGCGCCGTCCAGTCTGAACATCAATCTTTTTAGCCAGAGATATCATAGCCGCTCTTAG
AGTTTCAGCGTGATTTTCCAACCTAAATAGAACTTCATCGTTGCGTTTACAACACTTTTCTATTTGTTCA
AACTTTGTTGTTACATTAGTAATCTTTTTTTCCAAATTAGTTAGCCGTTGTTTGAGAGTTTCCTCATTGT
CGTCTTCATCGGCTTTAACAATTGCTTCGCGTTTAGCCTCTGGCTTTTTAGCAGCCTTTGTAGAAAAAAA
TTCAGTTGCTGGAATTGCAAGATCGTCATCTCCGGGGAAAAGAGTTCCGTCCA

Protein Sequence
>YP_233032.1 IMV surface protein [Vaccinia virus]
MDGTLFPGDDDLAIPATEFFSTKAAKKPEAKREAIVKADEDDNEETLKQRLTNLEKKITNVTTKFEQIEK
CCKRNDEVLFRLENHAETLRAAMISLAKKIDVQTGRRPYE

Molecule Role Protective antigen
Related Vaccines(s) Vaccinia virus DNA vaccine 4pox
References