VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Cov19VaxKB
Vaccine Mechanisms
VaximmutorDB
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign2
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

IFNG

Gene Name IFNG
Sequence Strain (Species/Organism) Sus scrofa
NCBI Gene ID 396991
NCBI Protein GI 47522726
Genbank Accession CU694828
Protein Accession NP_999113
Taxonomy ID 9823
Chromosome No 5
Gene Starting Position 35374420
Gene Ending Position 35379184
Gene Strand (Orientation) +
Protein Name interferon, gamma
Protein pI 10.07
Protein Weight 18822.46
Protein Length 166
DNA Sequence
>gi|347618789:35374420-35379184 Sus scrofa breed mixed chromosome 5, Sscrofa10.2
CCAGAAGCTAACTCTCTCCGAAACAATGAGTTATACAACTTATTTCTTAGCTTTTCAGCTTTGCGTGACT
TTGTGTTTTTCTGGCTCTTACTGCCAGGCGCCCTTTTTTAAAGAAATAACGATCCTAAAGGACTATTTTG
TAAGTATGACCTTTTAATAATACTTGCTTGTAGTTGAGTAGACTGATGCTGAATTGGAATTGTGTCTATG
ATGGACTCTCGTCTCTAATCCACAAGTCATCTTGAGAAGACTTGGTGTTATGGTGACTGTTTGTTGGCTG
GATGAGTTTTTTTGACTAGATGAGCTAGATATTTATTGTTTTAACCCTCTGTTCAATTTGCTATAGACAT
TTAAGGGAGAGTTCATGAATCCTCCAAAAGATGAGCATAGTATGGGTATAAATCTTCGTGTTGAGAATCC
ATTCAATTAGGATGTCTAGTAGTGAGTGTACTGAGAAAATGGGTATTAGTTTCTGACTTCTCAGGCTACT
AGGACAGTGACAGTCAAAGGTCAATATTAGCATTAAAAATGGTTATGAAATAACTGATCAATTACAGAAG
GTGAGGTCCTTAAAGCTTTGGCTTAAGAAATAATTTACAGGTATTTTTCTCTGAAAAGTAGTTTTAAAAT
TCTTCTATTCCATCTATATTGTCTGTGAATTACTCTTGGACTCAGTCACTTGCTGAGATTTTTTTGTAGG
AGTTATAATCTTATAGTTTTAAAATTGTTTTTGTTTTGTCTTATGAATTTCTTAATTTTTTCACTTACAG
TTAATTAAAATAGTTTTTGCACTTAAAATATTTTACGTCCAAAATTTAGCTGTTATAATTATAGCTGGGG
CAATTATAGTTGACACAATAACTTACAGGACATAGGTAGAGGTAATAGAAACCTTTACCATAGGGGGGCA
GTGTTTTGTAGTGAGATGGCTTTGCTGATTTTTTTTTTTTCCCCTTTAAATTTGGCTTAAAAATATTTTC
TTTTCCTTATTATACTTGTTTGGGACAATTGAAGTATCATCAGCCTTGTTGAGTTCATTTGTGATGTTTC
AATTTAAGAGTTAATACTAGAAAATAAGAAAGCTAAAATAACATGATAGTCTTTGGCTATATCTAACATG
ATGGTTTTTAAGAATACTTATTGATAGAACCAAACAGAGGGTGGAAGAGAAAATCAGTGGATATTGCTGG
CATCTGAATTCAGTAAAACTTGAAGTACAGTTTTTAGGGCAATTTATGGACTATTTGTAAACTAATCCTC
CCTCCCCCCCACCTTTTCCCCCCAGAATGCAAGTACCTCAGATGTACCTAATGGTGGACCTCTTTTCTTA
GAAATTTTGAAGAATTGGAAAGAGGTAAGCTGAACATTTCTATTTGGCTGATTTTCCTGTTGCTTATTTT
CTACTGGATAAATTCACATCACTCTCTCTTTGTGCTCTTTTCTCCCAAGGAGAGTGACAAAAAAATAATT
CAGAGCCAAATTGTCTCCTTCTACTTCAAATTCTTTGAAATCTTCAAAGATAACCAGGCCATTCAAAGGA
GCATGGATGTGATCAAGCAAGACATGTTTCAGAGGTTCCTAAATGGTAGCTCTGGGAAACTGAATGACTT
CGAAAAGCTGATTAAAATTCCGGTGAGATGAGCTTAATTCTTTTTTTGTTTCATTTGTAAAGGCTCTTGT
AAAACACTTCATTCCAGTAAAAATGGAAATTAGTTACTGGATACAGTTGTTAAAGCTATGGAGTGAACCT
GTAGTCAAAACTCCTCTTTGGTAATTATGTTTGTGCTTTGGGTGACTTGGTAAAGTCACTTATGGGAGTC
ATTCACATTTGTGATTTGGGAAAAGGCTGGCATTATGCCTACCACACAAAGACAGGTGAATGAGCAAATC
AGGGAGAAGGAAGTAGTGAAGAAGTTGAGGGCAGTGTTGGAAAGCAGTCCTCCCATTACCCCTTGTTTGT
GTGTTGGAAATTCTCTTGTTTTGAATAGCAGGCTGCACTTGTTAATGGAAAGAACAGTGGGAGGGGTGGA
GAAGATGTGAGCTCCTCCCAGTTCAAGCCACCAGAGACCTGTGTGACCACAGATGAATCACAGGCCTGGC
TGGGGCTGTTTCCTCATCTTAAAAGGAGTCTGTTGGCTTCACTATAATTTATATGGTCTCCTTTGCTCTA
AAGTCTGCAGTGCCATAGACAGAAAATGAGAATGAGATAGGAGGAAGGTATGACCTTGGAGGGGACAAGG
GGCCTCCTTCTGCCAGACTCTGGTCATCCTCTCACATTGTACAGCCCAAGTAATGGCAGAATGTTAGTTT
TTAGTAAAGAAAATAGGTAGAATTTATACCTTAGGAAAAAATTGTCCTATCCACTTTTGGATACCAGAGT
ATTTCAGCTGGAGAAATTTTTAGGGTCCCAAACTTTATCTTATTAAATTGTCTTGTCTTTAAAGTTATGG
TATCTAGAAGCTGAAAGATAACTTTGAAGCATAAAGACAAGTCATATTTTCAAAAATTTCATCTGAGAGA
TGAAGGCCTTAAGACTTGGGGATGGGGGTGAGCTTTGATATAATAGGCTTGAATGAGAAGAGGAGGGGTT
CCCGTTATGACTGTGCTCTTGGGATTTGTGCCCCAGCTCTCACTATAACTGGGTCTGCCTCTCACCAATC
TCTCATAAGCTCCCAGAAACTGAACGAAGTGCTTGCTCTTCAAGATTTCTCTAGTCTTTGGTAGATTAAA
TGGGACAAAAGTGGCTTGGAACAATTATAAGACCATTACTACTTCCACTGGTCATGTTTTGCAATGTCCA
ACAGATCTCCATTGGCTGCAGGCTAGAAAATAAAAAAGCACTTGTTCCTAACCCAGGGCAGCCCTTGGCT
TGCCATTCATGCTTTGAACCCTAGAAAGTAAAATTTATCACTTGCAAACACACAGCTGGTAGAAACTTTC
CTATTTTGCTATAATTGGGCCTTGAAAAAAAAAATCTGTTGGTCCCATCTTCTAGAATCTCCAAGCCTCC
TCCTTCATGATGGACAATCTTGAGTGGACTCTCAACCCTTGTCTTTTGCTCAGTTGCTAACATATTTAAG
GCTAACGTAGGATCTCCTAGTCATTGTAAGAAATTGGCAAGGTGGCCACAGTATACGCAGCTTTAGAAAG
AAATGTAGGAGTTCCTGTTGTGGTGCAGCAGAAACAAATACAACTAGGAACCATGAGGTTTCGGGTTCAA
TCCCTGGCCTTGTTCAGTGGGTTAAGGATCTGGCATTGCCATGAGCTGTTGGTGTAGGTCGCAGATGTGG
CTCGGATCTGGCATTGCTGTGGCTGTGGTGTAGGCTGGCAGCTGTGGCTCCAATTAGACCCCTAGCCTGG
GAACCTCCATATGCCGTGGGTGTGGCCCTAAAAATACAAAACAAAAGAAAGAAAGAAAGAAGGTGAGAGA
GAGAGAGAGAGAGAGAAGGAAGGAAGGAAGGAAGGAAGGAAGGAAGGAAAGAAAGAAATATAGTAGCAAA
GCAAAGATGAAAATAAGTAGTCTTCATTTTATGAAACATAGATTCACCTAAATGGTCCTATTGGAGAACA
GGACCAACTGAACAGTGAGAAAACAGTTCAATTTGCTGGAATGGAAGGCAGGGTGTAGGGAAATTTGCTT
TCATTCCTAAAGTGTTACATACCAGCAATTGATTATTGCATATAAATATGATCAGTATTTATTTTTAATT
GCATTATGGAAATGATAAGACTGACCTAATTTGGGAGAAATTAAAAATGATGTTTTTCATCTGCCTTGGA
CTTGGTGTTTACGAAGTACTGAATCTATACCAGTGGTTCTCAAACTTTGGTGGTGTCTGAATCATCTGGT
GATGTTAATAACTATGCAGTGGCCCAGGCCCAGTCCAATTTCATGCCTCTGGGTCTCTGAGTGTTTCATT
AGGTCTCCAGGTTATTCTGCTGCATGCCAAAATTGAGCGCCATTGCCTACAGTAACTCGTTTGATGCTTA
TGGCACAGACTGCATACAAAGTGATAGAAGTGGTAGAGAACCTGGAGGTCATCTGAACAACCTCCTCATT
GTTTAGAGGAAAAAACAGAGATTTGGAGAGGTTAAGGGACTGGTTTAAAGTTAGATGTATTGCACACACA
GAATTCAAACTCACATTTCTTGGTCCCTCACTCTACTTCGGGGCTCTTTTCACTATATAATTTTCAGCAT
TCCATAGCAGTAAATTTAAGGATATGTGATGTCTCCCATGATGTAACAGCACAACTAGCAATTTAATTAT
AATTTTAGTCTTAATTAATGAAGAAATCAACATCTCATATTAAGCTAATGTATTGCTAGTGAAAATAATT
TATTTTAAAGGAATACTTCCACTTTTATGGACCATGACAGCAGAATATCCTGATGGCTCATATGCCTGAA
ATTAATTTTGCTGTTTTCTCTCCCAACAGGTAGATAATCTGCAGATCCAGCGCAAAGCCATCAGTGAACT
CATCAAAGTGATGAATGATCTGTCACCAAGATCTAACCTAAGAAAGCGGAAGAGAAGTCAGACTATGTTC
CAAGGCCAGAGAGCATCAAAATAATTGTCATCCTGCCTGCAATATTTGAATTTTTAAATCTCAATCTATT
TATTAATATTTAATATTTTACATTATTTATATGGGGAATATTGATTCATTGATCAAAGTATTTATAATGT
AACTTTTATGTGATGAAAATGGGTATCTATTAACATATGTGTTATTTATGATTCCTGTATCCTGTGACTA
TTTCA
Protein Sequence
>gi|47522726|ref|NP_999113.1| interferon gamma precursor [Sus scrofa]
MSYTTYFLAFQLCVTLCFSGSYCQAPFFKEITILKDYFNASTSDVPNGGPLFLEILKNWKEESDKKIIQS
QIVSFYFKFFEIFKDNQAIQRSMDVIKQDMFQRFLNGSSGKLNDFEKLIKIPVDNLQIQRKAISELIKVM
NDLSPRSNLRKRKRSQTMFQGQRASK
Molecule Role Other
Related Vaccines(s) PRRSV DNA vaccine pIRESorf5/IFN╬│
References