VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign2
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

CCR2

Gene Name CCR2
Sequence Strain (Species/Organism) Homo sapiens
NCBI Gene ID 729230
NCBI Protein GI 183979980
Locus Tag hCG_14621
Genbank Accession ABBA01024718
Protein Accession NP_001116513
Taxonomy ID 9606
Chromosome No 3
Gene Starting Position 46395234
Gene Ending Position 46402412
Gene Strand (Orientation) +
Protein Name A
Protein pI 9.25
Protein Weight 38937.74
Protein Length 374
Protein Note Also known as CKR2; CCR-2; CCR2A; CCR2B; CD192; CKR2A; CKR2B; CMKBR2; MCP-1-R; CC-CKR-2
DNA Sequence
>gi|224589815:46395234-46402412 Homo sapiens chromosome 3, GRCh37.p10 Primary Assembly
CTTTATTCTCTGGAACATGAAACATTCTGTTGTGCTCATATCATGCAAATTATCACTAGTAGGAGAGCAG
AGAGTGGAAATGTTCCAGGTATAAAGACCCACAAGATAAAGAAGCTCAGAGTCGTTAGAAACAGGAGCAG
ATGTACAGGGTTTGCCTGACTCACACTCAAGGTTGCATAAGCAAGATTTCAAAATTAATCCTATTCTGGA
GACCTCAACCCAATGTACAATGTTCCTGACTGGAAAAGAAGAACTATATTTTTCTGATTTTTTTTTTCAA
ATCTTTACCATTAGTTGCCCTGTATCTCCGCCTTCACTTTCTGCAGGAAACTTTATTTCCTACTTCTGCA
TGCCAAGTTTCTACCTCTAGATCTGTTTGGTTCAGTTGCTGAGAAGCCTGACATACCAGGACTGCCTGAG
ACAAGCCACAAGCTGGTGAGTTGTAGGCATTTTTTCCATTACTTTCTGATTCATAGGCTCAACGCACCTC
AAAGCTGGAAATGCCGGGTCTGGGTACACCCTGGGGAACTGCAAAGCCTGCACACTTGGGGGGAATGATC
AAGATGAGAGGCAGGGGTGGGGATGGCATGTGCACCAGGAGATGTTAGAGAAACCCTGAGGAAGAGCAGC
GTGCAGCAGGTGATGGGGGAGAGTGGGCAGCAAGCGAGGCCAGGACAGCCACTCTGCTCAGTCACCAGTC
CACACACCCAGGGGCTCACTCTGCCCCTCTGAGCACCCAAGGACGTTAAAGAGCTGGAACTGTTAGTCTA
AATATAGGACCATCCAAGCTCTGAACCAAAATGTGTCCCTTGCCTCAACTCAGGAGATCCACAGAGGCAG
AAGTAAGGAATTTATTTTCTGAAAGATAGATTTCTATCAGTTCTGGGTGACATGTTCTGACACTTGAAAT
GACACCTAGGACAGCACATTTCAGGCATCTTGCTCATTGTTCACTGTAGTAGAAGCTACATGCTAGCCAG
TTGTAAAAATGAAATTAAGTAATGTGTGCACAGCATTTAACATAGCATCTGAGCTTCAGGAGCACTCAAT
TAATGACCACAGTTGTGATTCTTTAGGCAGATGCATTTTTTTCCAACTTTGATCAGAGGTCTTATTTAGC
TTCTCCAGATTTCAAGAATCTGGCTCAGTGATATGAAATACAAGACTTGTGAAAAGTGTCAATTGCAAGA
GAAATGGAAGGATAAAGTATACAGGTGGGTGGAAAAGAAATTCACAGTCACTGCCAGAAAAAAAATTCTT
GAGAATCAAGTCCTGATGATGTTAGGGCTTATAGTTCTTATTATAAAGAGTTTTATGTACTCATTCAGTG
AACATTTATTGGTGCCTCCTTTAGCCAGGTACTATCATAAGAGCTGAAAATAGAAGCATAATCCAGTCCT
TGATCTTGAGGAACATGCTGTGTGTAGCAGATAACATAATAAGTGCTTATCTAGATGCATGCAGTGTTAT
GTGATAAGAGTAATATGACAGAGGATACAGATTAGGCTTCACAGAGAAGGGGGATTTGAGCAGGAGGTAT
TGAAGGGTGAATAGAAGCTCACCAATCATTTTGGGCAGAGGGGCAAGGACCTGCAAAACCACTGAAGCAT
GAAGGAAATGGTGAGTTTAGGGAAAATGAAGAGAAGATGGCTGTGACTGAAGCACAGGATTTGGGATTGG
AGAAGGGACTGGAGGTGAGGCTGAAAAGAGGCAAACTCAGAAAAGATGTTGTGCTGGGCAGTCTGGACAT
TATCTTTGAAGCCCACCACATATAAGTCATAGGGCTACTGGAGGTTTTAAGCTAAGAGTGACTATTCAAT
TTCAACTTAAGAGAAGATAGGTTGAGAGGGAACATGGCTTGAGATGAGCCATGAGCAAAGGAAAGACTAC
AACAAAGCCAGGAGTGAGGAGTGTGTGAAGCAAGAAAGTGACAGTTGAAAGCAGTGCAGAGGGGATGAAT
CTGAGAGGCATCTATGAGGTGGAACTCAAATGACATGATAATAATACAGGGCATTTCTCTGTGTCAGATG
CTGTCCTAAGTCCTTACTCCATTGATCTTCACAGCAACTCAGCATAGTTAATATTTTATGCATAAAGAAA
TCGGCACTTGAAGGAGTAATTGGCCCCAGATTACACTGCCTATAAGGATTCAAATCCAGGTTTGTTTGGC
TCCAAAAACTGGCTCCTAATTTTCAGAAGGAGAAGCAACCCAGGGCAATGCCCAATTTTGCTTCTTAGGC
AATGGAGGAATCCACAATCGGAAGGAGTTTTCAGCAGTGCCCCATTTGGGGTGGGTTGAATTTGAGGTCC
CTGCATGATACCCACTTTGCTCACTTCAGTGCCTAAAACTGAGTATGGTTCATAGTAGGTGTTCAATAAG
TGTTGATGCAGTGAATACATGCATGGGGAGATATGCATCAGGCAATGGGAAATTCAACTCTAAGGCTTAG
GGGAAAGCTGGAGCTTGAAGACAGAGCTTTAGAAAACAGTAGCATAGAAGGGAGTAGGAACCATGAGTTT
AGACAATACAATTCAGGAAGAACTTTGTAGCAAGGATAAAGAGGCAAAAAATTAAAGAGGTGAGAGCTAA
GTGTGGTGCCTGGGGAATCTTAAGGTGTGGGCACGGGGAGGAGATGCCAGCAAAGAACATGAATAAAAAG
CGGTAGCACAGCCCCTCCCATCTGGAAGCCAAAAAGAATTGTAAATGGAGGAAGTTAGCAGAAGGATCAA
ATACTTGAAGAGGGTGGAATTGGAATAAAACCAGGGCATTTGAAAAATTGGGTTGTCACTGCAATCTTAA
CAAGAGAAGTTTTGGCAGGATGATGGAGGCAGAAAGCTGAGAGAATCATCAGTTAGAACGTTTTTGACTT
CAGAGAACAGAAAATGCAGTTCATAATGGCTTTAAAACAGGGGCTTGTTTTTCTCCCAGCAATTTGAGAG
GCCAAGGCGGGTGCATCAGGAGGTCAAGAGACCGAGACCATCCTGGCCAACATGGTGAATCCCCATCTCT
ACTAAAAATACAAAAATTAGCGGGGCATGGTGGTGCACGCCTATAGTCCCATCTACTCAGGAGGCTGAGG
CAGGAGAATCACTTGAACCCAGGAGGTGGAGGTTGCAGTGAGCTGAGATCATGGCCACTGCACTATAGCC
TGGAGACACAGCGAGACTCCGTCTCCAAAAAAAAAAAAAAAAGAAGGCAGAAGGTGAATAGTTCAAGGGT
GGGTTTAGGACTCAGTGATAATAGGATTCTGCCTGGCTTCTCATGGTTCTCTAGGTCTTCCATTCATGGC
ACCATGCCCTCACTAGGCATGCTGCCAGAGCAGGAGGGGCAGGTGGAGGGTTCTCTTGTGTCTGTCTTAT
CAGGGAAGAAGAGCTTTCTCAGAAGCCCCCAGCAGACTCCCTTTTCATATTATGGTCCAGCAATGAGTCA
CAGACCTATGCACCACCTGCAAAGGAGCCAGAGAAAACAAACGCCCAGCGCTTTTAGCCTGAAAATGAGA
ATCTGGTTTGCTGGGGAAGATAAAGGGTGTCGGAAAATGGCTGTTGGGTAAATCATTGATGTCTGCCACT
AGGAATGAAAGGCAAATCAGGAACTGGCACACATGCTTTCAGGGAGATGGCTGCAAGGGAGAGGGCAAAG
ACTGGGAAGTTGCTTATGTGGTGCCAGACTATTTGGAAGATCATGGATTGCGGTGTTTGTGTTGTGTGGT
CATCATTTTGTTCTTTGTTTACAGAACAGAGAAAGTGGATTGAACAAGGACGCATTTCCCCAGTACATCC
ACAACATGCTGTCCACATCTCGTTCTCGGTTTATCAGAAATACCAACGAGAGCGGTGAAGAAGTCACCAC
CTTTTTTGATTATGATTACGGTGCTCCCTGTCATAAATTTGACGTGAAGCAAATTGGGGCCCAACTCCTG
CCTCCGCTCTACTCGCTGGTGTTCATCTTTGGTTTTGTGGGCAACATGCTGGTCGTCCTCATCTTAATAA
ACTGCAAAAAGCTGAAGTGCTTGACTGACATTTACCTGCTCAACCTGGCCATCTCTGATCTGCTTTTTCT
TATTACTCTCCCATTGTGGGCTCACTCTGCTGCAAATGAGTGGGTCTTTGGGAATGCAATGTGCAAATTA
TTCACAGGGCTGTATCACATCGGTTATTTTGGCGGAATCTTCTTCATCATCCTCCTGACAATCGATAGAT
ACCTGGCTATTGTCCATGCTGTGTTTGCTTTAAAAGCCAGGACGGTCACCTTTGGGGTGGTGACAAGTGT
GATCACCTGGTTGGTGGCTGTGTTTGCTTCTGTCCCAGGAATCATCTTTACTAAATGCCAGAAAGAAGAT
TCTGTTTATGTCTGTGGCCCTTATTTTCCACGAGGATGGAATAATTTCCACACAATAATGAGGAACATTT
TGGGGCTGGTCCTGCCGCTGCTCATCATGGTCATCTGCTACTCGGGAATCCTGAAAACCCTGCTTCGGTG
TCGAAACGAGAAGAAGAGGCATAGGGCAGTGAGAGTCATCTTCACCATCATGATTGTTTACTTTCTCTTC
TGGACTCCCTATAATATTGTCATTCTCCTGAACACCTTCCAGGAATTCTTCGGCCTGAGTAACTGTGAAA
GCACCAGTCAACTGGACCAAGCCACGCAGGTGACAGAGACTCTTGGGATGACTCACTGCTGCATCAATCC
CATCATCTATGCCTTCGTTGGGGAGAAGTTCAGAAGGTATCTCTCGGTGTTCTTCCGAAAGCACATCACC
AAGCGCTTCTGCAAACAATGTCCAGTTTTCTACAGGGAGACAGTGGATGGAGTGACTTCAACAAACACGC
CTTCCACTGGGGAGCAGGAAGTCTCGGCTGGTTTATAAAACGAGGAGCAGTTTGATTGTTGTTTATAAAG
GGAGATAACAATCTGTATATAACAACAAACTTCAAGGGTTTGTTGAACAATAGAAACCTGTAAAGCAGGT
GCCCAGGAACCTCAGGGCTGTGTGTACTAATACAGACTATGTCACCCAATGCATATCCAACATGTGCTCA
GGGAATAATCCAGAAAAACTGTGGGTAGAGACTTTGACTCTCCAGAAAGCTCATCTCAGCTCCTGAAAAA
TGCCTCATTACCTTGTGCTAATCCTCTTTTTCTAGTCTTCATAATTTCTTCACTCAATCTCTGATTCTGT
CAATGTCTTGAAATCAAGGGCCAGCTGGAGGTGAAGAAGAGAATGTGACAGGCACAGATGAATGGGAGTG
AGGGATAGTGGGGTCAGGGCTGAGAGGAGAAGGAGGGAGACATGAGCATGGCTGAGCCTGGACAAAGACA
AAGGTGAGCAAAGGGCTCACGCATTCAGCCAGGAGATGATACTGGTCCTTAGCCCCATCTGCCACGTGTA
TTTAACCTTGAAGGGTTCACCAGGTCAGGGAGAGTTTGGGAACTGCAATAACCTGGGAGTTTTGGTGGAG
TCCGATGATTCTCTTTTGCATAAGTGCATGACATATTTTTGCTTTATTACAGTTTATCTATGGCACCCAT
GCACCTTACATTTGAAATCTATGAAATATCATGCTCCATTGTTCAGATGCTTCTTAGGCCACATCCCCCT
GTCTAAAAATTCAGAAAATTTTTGTTTATAAAAGATGCATTATCTATGATATGCTAATATATGTATATGC
AATATATATAGGCTCTTGCTTGATCTCTCCAGGAGGTAGTGATTATGAGAAGGGGGTGGAGAATGATGAG
TTCCTTCACCAGGAGCAAAGGACGGGGATCGTGTGGAACCACTGCAGAACTATTTCCGAAATCAACTAAG
TGGAGAGAGCCAGGAAGGCTGCATCAGAACCCAGTAAAGCTTCTTGTCTGGATCTGAGCTGGTTTGTTTT
GTGCTTGCTTTTCCCTGCCTTGCCACTCCCCTCACTCTTCTCTTTTCCCCACAGCCTTTTTCACATAGCT
CTTGGCTGTAGGATTGCCCCACTCCAAAAACCAGTGTGTGGAGGTCCAGGAGTGAGACCAGGAAAGAATG
TGAAAGTGACTACACAAGGACTCCTCGATGGTCGTGGAAAAGGAAAGTCAATTGGCAGAGCCCCTGAAGC
CAGTCTTCAGGACAAAGAAGGAGCCTAGAGACAGAAATGACAGATCTCTGCTTTGGAAATCACACGTCTG
GCTTCACAGATGTGTGATTCACAGTGTGAATCTTGGTGTCTACGTTACCAGGCAGGAAGGCTGAGAGGAG
AGAGACTCCAGCTGGGTTGGAAAACAGTATTTTCCAAACTACCTTCCAGTTCCTCATTTTTGAATACAGG
CATAGAGTTCAGACTTTTTTTAAATAGTAAAAATAAAATTAAAGCTGAAAACTGCAACTTGTAAATGTGG
TAAAGAGTTAGTTTGAGTTACTATCATGTCAAACGTGAAAATGCTGTATTAGTCACAGAGATAATTCTAG
CTTTGAGCTTAAGAATTTTGAGCAGGTGGTATGTTTGGGAGACTGCTGAGTCAACCCAATAGTTGTTGAT
TGGCAGGAGTTGGAAGTGTGTGATCTGTGGGCACATTAGCCTATGTGCATGCAGCATCTAAGTAATGATG
TCGTTTGAATCACAGTATACGCTCCATCGCTGTCATCTCAGCTGGATCTCCATTCTCTCAGGCTTGCTGC
CAAAAGCCTTTTGTGTTTTGTTTTGTATCATTATGAAGTCATGCGTTTAATCACATTCGAGTGTTTCAGT
GCTTCGCAGATGTCCTTGATGCTCATATTGTTCCCTATTTTGCCAGTGGGAACTCCTAAATCAAGTTGGC
TTCTAATCAAAGCTTTTAAACCCTATTGGTAAAGAATGGAAGGTGGAGAAGCTCCCTGAAGTAAGCAAAG
ACTTTCCTCTTAGTCGAGCCAAGTTAAGAATGTTCTTATGTTGCCCAGTGTGTTTCTGATCTGATGCAAG
CAAGAAACACTGGGCTTCTAGAACCAGGCAACTTGGGAACTAGACTCCCAAGCTGGACTATGGCTCTACT
TTCAGGCCACATGGCTAAAGAAGGTTTCAGAAAGAAGTGGGGACAGAGCAGAACTTTCACCTTCATATAT
TTGTATGATCCTAATGAATGCATAAAATGTTAAGTTGATGGTGATGAAATGTAAATACTGTTTTTAACAA
CTATGATTTGGAAAATAAATCAATGCTATAACTATGTTG
Protein Sequence
>gi|183979980|ref|NP_001116513.2| C-C chemokine receptor type 2 isoform A [Homo sapiens]
MLSTSRSRFIRNTNESGEEVTTFFDYDYGAPCHKFDVKQIGAQLLPPLYSLVFIFGFVGNMLVVLILINC
KKLKCLTDIYLLNLAISDLLFLITLPLWAHSAANEWVFGNAMCKLFTGLYHIGYFGGIFFIILLTIDRYL
AIVHAVFALKARTVTFGVVTSVITWLVAVFASVPGIIFTKCQKEDSVYVCGPYFPRGWNNFHTIMRNILG
LVLPLLIMVICYSGILKTLLRCRNEKKRHRAVRVIFTIMIVYFLFWTPYNIVILLNTFQEFFGLSNCEST
SQLDQATQVTETLGMTHCCINPIIYAFVGEKFRSLFHIALGCRIAPLQKPVCGGPGVRPGKNVKVTTQGL
LDGRGKGKSIGRAPEASLQDKEGA
Molecule Role Vaximmutor
Related Vaccines(s) APSV Wetvax , Fluarix , FluMist
References