VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Cov19VaxKB
Vaccine Mechanisms
VaximmutorDB
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign2
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

PTGS2

Gene Name PTGS2
Sequence Strain (Species/Organism) Homo sapiens
NCBI Gene ID 5743
NCBI Protein GI 4506265
Genbank Accession ABBA01027702
Protein Accession NP_000954
Taxonomy ID 9606
Chromosome No 1
Gene Starting Position 186640943
Gene Ending Position 186649558
Gene Strand (Orientation) -
Protein Name prostaglandin-endoperoxide synthase 2 (prostaglandin G/H synthase and cyclooxygenase)
Protein pI 7.41
Protein Weight 65522.03
Protein Length 604
Protein Note Also known as COX2; COX-2; PHS-2; PGG/HS; PGHS-2; hCox-2; GRIPGHS
DNA Sequence
>gi|224589800:186640943-186649558 Homo sapiens chromosome 1, GRCh37.p10 Primary Assembly
ATCTTCAGAAAAGATCTGTCAATTTTTAAATAGTACAAAAATAAACAGACATTTATTTCCAGACTTATCT
TTTACATAAGTTAAATACACATTTGTCTGAGGCACTGAAACATTCGCATACACAACCCAAATTCCCAGGT
TTTGTCAGCAGATCAATGTTAATAACAAATCAAGTTTTTTTTTTAAAAAAAACAGTGAACAGTGTTTTAT
ACAAGCATATTGACTATTTCTTTCTTAACCTTAAACATTCTAAACGTAAAATTGTAAAGAAGATTCTCCT
GAGTTATCTTTAATGATATTTATTTCATTTTCTCCCTCTTCCCAAAAGAAAATTTTTTTCAATTATTTAT
ATAAATACTATTATCTGTAATCAGCGTTTGATTTAAAAATATTAAAACCCACAGTGCTTGACACAGAATA
TTTTCTCAATAAATTGTGGCTGAACAAATTAACGAAGCATCCACAGATCCCTCAAAACATTTTAAAAGGT
CAGTCTTATGGCACATTCAGGCTAATGAGACAATATTCTTTGTGGGCTAGCACATAGGCCTATCCTAAGG
ACAAACATTCAACCTTAAATATCTCAATATGCCAATCAGATTTCTAAAAATTTATTCACAAATCTTAATA
CAATCATTTCTTTGGATTGTTTACATAATATTCAGAGAGGTAACCCCAAAGAAGATATACTGATTGTGAC
ATAACAAAAAAAAATCAATGATTGTAGGCTTAAACACAGTTTATAACCATAGTGTCCTAATAAGACATAA
ATAATAATCTTCAATAAATTAAGTAATATACAGTACCATTAAATGTCAGTGACAATGAGATGTGGAAAAG
AAGTATTATCGTCATTATTATTATTGCTGAGAACTACTTAGATATCATTTGGTTTTGTTTTTAAATAAGA
AAGGGCATTAATTAGAATGGGAACGTAACTTTTTCCAGTCACAAACCCCGTACAGTTCTCTCTGAGGCAC
TAGCCTCTTTGCATCCATCTTGGTTACAGATAGCTAAAATTAGCTATAAATAAAATTCTCTGCTTTTCAC
TTAAAATAAGTGTATACTATTTTTAAAAGGGCCTTTTTTTTTCTCTTTTAATCTTCTTAAGAGGAGCTAA
ATAGCAGTCCTGAGCTGAGGTTTACCTGAAAACTTGCAAAAGTTCAGGTAAGAAAATATAGGCAGAGTCC
AAAGAAAGTGAACTCTGATCTTAAAACTAGTAAAACAAAATAGGAGAAACGAAGTGATGAGAAGACTGTG
TCTCTTAGCAAAATGGCTAAAAGAAGAAAAGAAAAGGAACAGCATGCAGGTAGCCAGGCTTGATTCCAAT
GCACCTACTGAATTGGCTTCAAGACTGAGATAAAATTAATGTGTGAAATGAATTTAAGCATTTTGAAGAG
GTATTTTATGAGGTCATTGCTACTTTTGCAATGTGATATGGACTGCTAAATTAAACTGTACAACAGAAAA
TCTGAGAAAACATATCATTATTCAAGCACAGCTTGGTACTTCATTAACCTCATAGCAAAATCTGAGTACC
AGGCCTGCAGTGCACAAGGATAAAAAAAAGTTTGCTTCAAAAGTTTAAACCTAAATTTGAACAATAATTT
GGTTTTCTTCTTTGTTATTGCTTATTTTAAAGGTAGACCCTTTTGCTGATATAGATTTTACATGTTACCA
GCCATATAAACAAATTCTGGAATATCTCAACAAAATATTCTTATTTTAAGATAACACTGCAGTGGCTCCA
CCACCTTAATAAATTTGGCATTTTGATTTAAAAGGAAGTTTTAACAGTCACACTAAAAAGGTTTATACTC
TTGGTGAAAAAGGAACATCACTTATAAAATATTTTAACAAGCAATTGTAGTAAAATTTCTACTGATTTTA
CAGATTTAAATCCAAGACAGCTTCTTTTTGGTATATGTACAAGTTTAATAACTTTAAGAAATCAAACAAG
CTTTTACAGGTGATTCTACCCTATGAATTTAGAAATTTCAAATTATTGTTTCATTGCTGATTTTAAAAAG
TAGACATGAAATTACTGGTAATGTCTAATTTAAATATTCATTTAATAATGCACTGATACCTGTTTTTGTT
TGATGACAGAAAAATAACCAAAAGTACTTTAAAATTTCAAACATTAGTTACTTCTAATGCATCATGGAAG
ATGCATTGGAAACATCGACAGTGTAAAAACTTTCAGCATTTTGCCATCTTGTGACAGTGTTTAAGTATTC
AAACATCTTTACTTTCGTTCTTATAATATAAGTTGAAATTCAAGTAAAAAGACGTCAAAACTCATTTCTC
TCTGGTTTATAAAACAGAATAAAAACTGTTTTCCAAACTTAACAGCAACAGCAAAATCTTTAGAGTAGTG
ACATAAAAGTCTTCACAAGTATGACTCCTTTCTCCGCAACAGGAGTACTGACTTCTGTTACAGAAGATGT
TAAGTAACATAAGGAGTTTAATATAAATATTATTAAATAATTAAATTAATAGACATGGTTCATATAAATA
AATAAATATGATCATTAGACTTCTACAGTTCAGTCGAACGTTCTTTTAGTAGTACTGTGGGATTGATATC
ATCTAGTCCGGAGCGGGAAGAACTTGCATTGATGGTGACTGTTTTAATGAGCTCTGGATCTGGAACACTG
AATGAAGTAAAGGGACAGCCCTTCACGTTATTGCAGATGAGAGACTGAATTGAGGCAGTGTTGATGATTT
GAAAACCCACTTCTCCACCAAAAGTGCTTGGCTTCCAGTAGGCAGGAGAACATATAACATTACCCATAAG
TCCTTTCAAGGAGAATGGTGCTCCAACTTCTACCATGGTTTCACCAAAGATGGCATCTGGCCGAGGCTTT
TCTACCAGAAGGGCAGGATACAGCTCCACAGCATCGATGTCACCATAGAGTGCTTCCAACTCTGCAGACA
TTTCCTTTTCTCCTGTGAAGGCGATGAAGACAGAGATACAACCAATGTCAAACTTCACAAAATAAAAAAC
AGTTTGATTCTTTTGCTCAATTTGCTGCCAACTTCTCTGTTTCCATTTGACCCCTGATTCTTTTAAGAAG
TTTAGGGGCCAGGCGCGGTGGCTCACGCCTGTAATCCCAGCACTTCGGGAGGCCGAAGCCGGCGGATCAC
TAGGTCAGGAGTTTGAGACCAGCCTGGCTAACACGGTGAAACCCCGTCTATACTGAAAATACAAAAAATT
ATCCATGCGTGCGACGTGAGCCTGTAGTCCCAGCTACTCAGGAAGTTGAGGCAGGAGAATTGCTTGAACC
CAGGAGGCGGAGGTTGCAGTGAGCCGAGATGGCGCCACTGCACTCCAGCCTGGGTGACAGAGGGCGGCTC
CATCTCGAAAAGAAAACCAAAAACAACAAAAACAAACAAACAAACAAAAAACGAAGAAGTTTAGAAACTG
TTTCTTACCTGTAAGTTCTTCAAATGATTCATAGGGCTTCAGCATAAAGCGTTTGCGGTACTCATTAAAA
GACTGGTATTTCATCTGCCTGCTCTGGTCAATGGAAGCCTGTGATACTTTCTGTACTGCGGGTGGAACAT
TCCTACCACCAGCAACCTGTGGAAAGTAAAATTAGTTGTAAAACAAGAATTTTAGGCATATTTACTGTTT
GTATTCAGCTTGCCTTAGGTACAAATCAGGTAAAACTGAAACTCCCAGCGGAGACAATTTTTATTTGCTG
GAAAGATGCTTACCTACATTTCAACAGGAGCTCTGCTTAAAATTCAATGGGACACCAGCCTAGAACTAAT
TTGCCTTTTTACATTTCAAAAATAACACTAGTATTCAAGCCTAAAATATTTATTCCTATAAGATTATAGA
TACTTTTTGAAAATATTTTTAAGGTAGGGGTACAATTTGCTATTTGTCTGACAACTGTAGACTAGACTAA
AAGTTTAGACTTTTCAAACAAAGTTAGGCTTCTTATATCAATAAAATAATTTTACTAGCAATATAACTAA
CTACTCTTTTAGTAAGTTTAAGAAAAATAATTTCCGTGGCAGAAATTCTAAAGTTACTGACTAGTCTTTT
GTTTTGGTTTTCAATAATAATGCTTACCCTGCCAGCAATTTGCCTGGTGAATGATTCAACAAACTGGGTA
ATTCCATGTTCCAGCAATATAGAGTTGTTGTAGATAAACTGTTGATAGTTGTATTTCTGGTCATGAATTT
GAAAGGTGTCAGGCAGAAGGGGATGCCAGTGATAGAGGGTGTTAAATTCAGCAGCAATACGATTTTGGTA
CTGGAATTGTTTGTTGAAAAGTAGTTCTGGGTCAAATTTCAGTTTGAAGTGATAGCCACTCAAGTGTTGC
ACATAATCTTCAATCACAATCTTAATAGTCTCTCCTATTTGCACAAAATAAATAATAAAAACATTTATTG
CATCTGATCACAAGCTTTCAAGCAACTGGAATGCAATTTTTAAAATTTGCTATTCCTTCATTTCTGTTTT
CTTCCTTGTCAGTATCAAAAGATAGCTATTTTATCAGTCATGCTTACATATTTAATGTATATAGAATGTG
TGAGTTTTCATTTACCACATCTTGTCATTTACTCAAAACATAACAAAGATAGCACACTAATTTTCCCTGG
GGAAGAGGGTTTTATATAAATCATTTTCTTGTTTACCTATCAGTATTAGCCTGCTTGTCTGGAACAACTG
CTCATCACCCCATTCAGGATGCTCCTGTTTAAGCACATCGCATACTCTGTTGTGTTCCCGCAGCCAGATT
GTGGCATACATCATCAGACCAGGCACCAGACCAAAGACCTCCTGCCCCACAGCAAACCGTAGATGCTCAG
GGACTTGAGGAGGGTAGATCATCTCTGCCTGAGTATCTTTGACTGTGGGAGGATACATCTCTCCATCAAT
TATCTAAAAAAATAAATAAATAAATAAACATCAGTTAAAAAGTTAAGGAACACATTTTTAGGGATTTTAA
AATATGGGTATAAGCGGTAATAACTAAGTCTTAATAGTCAAAGGAAGCATACCTGATATTTCATTTTTCC
ATCCTTGAAAAGGCGCAGTTTACGCTGTCTAGCCAGAGTTTCACCGTAAATATGATTTAAGTCCACCTAG
AAAATGATGAAAAAATTTTAATTTGTTGCTGTTGAAGTTTTTCTTATATAAAGTGTCTATCATATAATTC
ATCATTAAATAATTTGATCATTTAGCTTTCTTTAAAATTTTTAAATAAAATATACATTTTTCATAGCCAT
GAATTGCTAAATTAATTTGTTTATCCACCAAAGCTACAAACTGATATGTCTTTGTGTTTAACGGAATTAA
TATACTATATTGAGCTTATATCATATATATTATATACTTCACTATGATGATATGGTAATTATAAAAAAGT
ATAAAAATGTATTATTTATAAAAAATTCTTACGAATAACTTGAAGCTATGCTATTGAAATCCAAAAAATA
ATAATGCGGCAAAAACCTCACTTTACAATATTGAAAGCGGCATAATCATGGTACAATGTGTTTTTGAGGA
CATAACATTTTGCAGTACTAACATTTTAAACTAAAAAATACAAGGGTCAAATTACAAATAACAATACCTG
TACATATGTATGTGTGTGAATGTTTATATATGTGTGTGCATGTCTGTGTGTGTGTATAATTTTACTAGAC
CAGTGAAGTAAATGGAAAATTCCTTTAAGGTTTTTATAGATAAGACTTCTTTTTAAAAAAAGTGGATAAG
TTATTTGGATCTATCTATCTGTATATCTCCTTTAATGTTAGCCCTTGACTATGATTTGGTATAATTTTAC
TAACTCTAAGATATTAACTCTATCTTACCCCATGGCCCAGCCCGTTGGTGAAAGCTGGCCCTCGCTTATG
ATCTGTCTTGAAAAACTGATGCGTGAAGTGCTGGGCAAAGAATGCAAACATCATGTTTGAGCCCTGGGGA
TCAGGGATGAACTTTCTTCTTAGAAGCAATTTTTCCACAATCTCATTTGAATCAGGAAGCTGCTTTTTAC
CTGAAAAATGAGAAAGCTAAGGTAAGAATCCATCTATGTATTCAAGAAAGGAGATGGTGACTGTCAATCT
ACCAAGAATTCTTCATTTATATGAGAATTACAATTGTGAATAGGATCATAATATAAACAACAGTTCTAAG
ATATGGTGGAACAACTTCTTACTGAATGATTTTATCTATTTTAATTAGAATTATTTCATTTCTAAAGAAA
TAATTTGAAAATATTAAGACATTATACCAAGACGCTCATTTGCTTTTACATAATAGTTTATATAGACTCA
TACTTTAAAAAATACCCATAGATAACCATGCTAAAAGTAAAAACTGCTTTTGTTAATAAATAAATGGTAG
TCTAAGGTCAATTTTTTTTTTTGGCAGCAATGCAGCCCGTCTTATAGTTAATACATCTCTAATGGATTCT
TCTTACTCACCTTTGACACCCAAGGGAGTCGGGCAATCATCAGGCACAGGAGGAAGGGCTCTAGTATAAT
AGGAGAGGTTAGAGAAGGCTTCCCAGCTTTTGTAGCCATAGTCAGCATTGTAAGTTGGTGGACTGTCAAT
CAAATGTGATCTGGCTGAAATTTTCAAAGAAAAAAATGTTTTATTTATTCTCATTTGTTAAGTAAATCAA
CCATTATTTTTATTGTAAAATGTGGAAAGTGGCACCTGAGGTTGAATGTAACTCCAAAATAAAAAAAATC
TATTTTTAAACAACTACACTTTATAGTCTAATGGCCACTTGAAATACATCTTTAATAAAATACATATACT
CTGCACATTATAATCTGGCAATATTGATTTTTCAGGTAGCCATCTGCTCACTATCCAAGAGGCCTATGAA
AGGAATGGCTGAGTATGGCACCCACTTTAGAATCATGGAAAGTTATTTTCTTGCTGATCCAAATCCAAAT
TTATTTTAATGGGTGCTACATGTTCAGAACAATTCTGTGGCCCATGGGCATTCAATAAACAGCTGGACCA
TGCTACCTCCACAAACTGACCAAACAGTAAAGGTTAGAAGAGGTATACAGAGTTGTGAGCAGACTGTATA
AACTGGATGGGACTAAATGTCAATATTTTTGGCGATTAAGATGGAAGGCAAACTTAAAAGCTATCTTAAA
GTCTTTTTGATAAGCTTGGAAATATGTTTTTAGATTAGGCTTACAGTATTATAAAGCATATTTTTCTTTG
AGAAGGCTAAAAACCTTAGAAAGACACTTGTACTTACATGTCAACACATAACTCATAATTGCATTTCGAA
GGAAGGGAATGTTATTCACAACGTTCCAAAATCCCTTGAAGTGGGTAAGTATGTAGTGCACTGTGTTTGG
AGTGGGTTTCAGAAATAATTTTATTCTTGTCAAAAATTCCGCTGCAAGAAGACGAAGAAAGGGAGGGAGA
AATTAATGGGACTCATTATAAGACACAAATCTATACAATGATAACTGTATCCAGCCCCACTCCTAATGAG
GCAACCAAAGGACAAACTTACGTGTTGAGCAGTTTTCTCCATAGAATCCTGTCCGGGTACAATCGCACTT
ATACTGGTCAAATCCCACACTCATACATACACCTCGGTTTTGACATGGGTGGGAACAGCAAGGATTTGCT
GCAATTAAAGGACAGCAAATAAATCATTCTCTAGTGTCTTAATCTTAATTTAAACATTTAATTGTTTGAC
TATGAATCAACTTTACAATAATAAATTCAAGAAATATATAGGTAGTCATGGAAATACAATTTTTTAACCT
GCCTTAGAATGGATAAAACGTAGAAATACCAATTTTCTATTCTAAATAAGGATAACAGCATATTCAACTT
GGTACATCATGTTACTAAGCTTTTCTTAGTTAACTCTTTAGATGTTAAAATTAGCATTTTTAAGAAGTTC
AAATAAGTAGCACTTCACTTTCCAAATTAAAATGGATCTAGTACACTAATCAACATTTAGGGAAAAATTC
AAAGTAAAACAGCTTACTTTTAAGACATTTTGCTTATCTTAAAACATAATCCGGGCTTTCCTGGGAGCAG
GAAAGAACTGACTAGAATATTTAAAACAACTTCTTCCACTCAATAAAAAGGTTCCAAATATAAACAATTC
ACATATATTGATCAGATCCTGTCTTATCATAATGACAACCTGCAAATTAGTATCATCTATCCCTATTTAG
GAGGTGAGAGTGTCTCAGATCGGTTAAGTAACTGGCTCATAATGATCAGTGCTTGTGGGAAAGCTGGAAT
ATCCACGGAGTTCTTTCGAACTCTAGCGGTCCAAGCTCTTTCCCAAGTCACGTAGCTTCTCTATTCGGAG
AGAAGTCGGAGTACTGGGATAGACCCAGGAGGTCAGAGCGGAAACTCTGCCCGGGTGCGTGGAACCGGAG
TCCCCGGTGCGCGGCGCCAGGTACTCACCTGTATGGCTGAGCGCCAGGACCGCGCACAGCAGCAGGGCGC
GGGCGAGCATCGCAGCGGCGGGCAGGGCGCGGCGCGGGGGTAGGCTTTGCTGTCTGAGGGCGTCTGGCTG
TGGAGCTGAAGGAGGCGCTGCTGAGGAGTTCCTGGACGTGCTCCTGACGCTCACTGCAAGTCGTATGACA
ATTGGT
Protein Sequence
>gi|4506265|ref|NP_000954.1| prostaglandin G/H synthase 2 precursor [Homo sapiens]
MLARALLLCAVLALSHTANPCCSHPCQNRGVCMSVGFDQYKCDCTRTGFYGENCSTPEFLTRIKLFLKPT
PNTVHYILTHFKGFWNVVNNIPFLRNAIMSYVLTSRSHLIDSPPTYNADYGYKSWEAFSNLSYYTRALPP
VPDDCPTPLGVKGKKQLPDSNEIVEKLLLRRKFIPDPQGSNMMFAFFAQHFTHQFFKTDHKRGPAFTNGL
GHGVDLNHIYGETLARQRKLRLFKDGKMKYQIIDGEMYPPTVKDTQAEMIYPPQVPEHLRFAVGQEVFGL
VPGLMMYATIWLREHNRVCDVLKQEHPEWGDEQLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPE
LLFNKQFQYQNRIAAEFNTLYHWHPLLPDTFQIHDQKYNYQQFIYNNSILLEHGITQFVESFTRQIAGRV
AGGRNVPPAVQKVSQASIDQSRQMKYQSFNEYRKRFMLKPYESFEELTGEKEMSAELEALYGDIDAVELY
PALLVEKPRPDAIFGETMVEVGAPFSLKGLMGNVICSPAYWKPSTFGGEVGFQIINTASIQSLICNNVKG
CPFTSFSVPDPELIKTVTINASSSRSGLDDINPTVLLKERSTEL
Molecule Role Vaximmutor
Related Vaccines(s) FluMist
References