VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign2
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

IKZF1

Gene Name IKZF1
Sequence Strain (Species/Organism) Homo sapiens
NCBI Gene ID 10320
NCBI Protein GI 334085209
Locus Tag tcag7.1178
Genbank Accession AACC02000075
Protein Accession NP_001207694
Taxonomy ID 9606
Chromosome No 7
Gene Starting Position 50344377
Gene Ending Position 50367357
Gene Strand (Orientation) +
Protein Name transcript variant 3
Protein pI 6.25
Protein Weight 50322.93
Protein Length 477
Protein Note Also known as IK1; LYF1; hIk-1; IKAROS; PRO0758; ZNFN1A1; Hs.54452
DNA Sequence
>gi|224589819:50344377-50367357 Homo sapiens chromosome 7, GRCh37.p10 Primary Assembly
GCGCGGCGCATCCCAGCCTGGGCGGGACGCTCGGCCGCGGCGAGGCGGGCAAGCCTGGCAGGGCAGAGGG
AGCCCCGGCTCCGAGGTTGCTCTTCGCACCCGAGGATCAGTCTTGGCCCCAAAGCGCGACGCACAAATCC
ACGTGAGTGTTTTCAAATTGAATTTCAATAGGAAAACTTGGGGTAACTGGTGAATTTAAAAAAAAAAAAA
CACAGTAAAGAAAAGCGGTAAGGTTGGTAGACCCTGGTGTCGCTCAGGTCCGCCTCTCTTTTCTGAGGAC
AGTGAGAGAGTTCACTTCTGTCAAGCGTCTGTTGCTCTGCACTGTGCCAGCAGGTGCAGGACCAGGCCGA
CATGGGACACTTCTGAGCAGCCCCGCTGTCACCAGGAGAGGAGTTCTAGCTCCCAACCATATTTAAATTT
ATGTAGACCTACATATACCCACGGAAGTCAGCCTTTATAAAGTCGTGTGTAAAGAGTTTTCCTTATATTT
GAGCCGGGAGCTTTCTTTTTATACTATAAATATGATGAGATCGAGTCTGAACTTAATTTCTGCAAGAGAG
GAATTATCCCGGCTTTGAAAAGTTAGTCCTTTTGCTGACCGCAGGTTTGACGCTCAAGTCACCAAACCTT
CTCAGGAAAACCCTTAGTAATATTAAGGCATCAGGTTACTTGCGGTTATATTTGAAATGTATTTTAAATA
TTTGTCAAGCATCGCTGCTGATGCCTAAGGAACCTCGTGAGGGCTTGTTTTTCCTTCTAATTTGGAGGCA
TCTAATGACCGAAAACCGTAGCGATTCCATAGGGTCTGACCAGGCACAGCTTTCAAATGCAGCTTCCCTC
TCTCTAGGGACTGCAGCCCACCCAGACTGAATTTCAATGCGGTGCGCTTTGCTTAGGTTACCCACTCACA
ATTTCCCACTGCGCCGCAGGCAGTATATTTCAGCTTTGAGATACCTTGTTTTAAAATTCCAGACAAAATG
GTGTTGAGGAAATGTCTCCTTACTAGTCCCATCAACTTCTGTTAAAAGAGGAAAATTTATGGAATTTGAA
AATACTGCGTATGATATTTAAACTTTCATAGACATTCAAATGCTTTTAAGGCCAGGTTCAATTTGGTTAT
GAGTCGAGGGGTGGGGGGGACCCACATAGAAATGTCCTGGGTCCTCTTGAGTTTATTTCTTTGTTTGAAG
ATGTTTGTTCAATGAGTTTTATTGTACTCATCTTTTATATGGAATTTTAAAAAGTAACAATTTCAGTATT
ATTTATATTAGAATGTGTCAGAATTATTTCCGTGACAAATCAGATCATTTGGGCTATGGCTTAAAATGTA
CACGAGGCAAATATTCATGACAAGAAGATTCACCTTCTTACGCTGGCATCTTGTAAAATGCAGAACAAGT
TAAAGAAATAATGTGTACACATACAAATAATGATGTCACATTAAAAATACTACACTATTCTTGCTTGATG
GAATGTATCTGATTTCCAATTTCACCATGAACATATTTCATACATTTTTTACATGAAAAAAAACGTGACT
CTTAAGTCTCACAGTCAATCAGAGCTGGTGACCAGAACATTTTATTGAACTAAATGGTCATGTTTTCTTC
CCCTTTTGTTTCACGGTGAGAGTTGAAGGAAGGAGTTTAGAAACTCTCCAGTACTTGTTTAATTCATCAG
TGTTCTAATTAGAGTGGTACCTCTTGGAAAACTACACACCCCCCTAATGCAGAAACATCATAGCAATAAT
CACCCACCCTCAGGGTCTCCAGGAGACCACAAGGGCTGCAGATAAAAGTCTGGATGTGTTAGGTTTGACC
CTTTCGAAGAGTTTTACACAGGCTCCTAAAGAGAAGATCAGCTGTGGCCGTTTGTAGCCATTTCCTTTGT
CGAAAAACTAAGATCGCAGTGAATGTATTAGCCAAGAGGTCTAAAGCCCTGTTGTACTGCAGGCCACTGT
CTTCCTTGTTTGACTAGAGACTTGGAGTTTGAGAACAGTGGTTCTTTGGTTTGGATACATTTTTTGTTCT
TGATTTGGATGTGTGTGTTTCATGCGTGGTTAATATAGCATATTTTCAATATAAATGTCAAAAATTTTGA
AATAGGAAAGAACTCTCTATATATTAATGTACTTATACACACACTTCAAGATTATGCATTTATTAACAGA
TACATGAAATAAATTCCATGTGCATATGCACATATGCACACAGAGCGTGCACACACACAGCATGCACACA
GCGTGGAGTGAGAGGCATGGGGCAGTGTGGAAGAGTTTTAACATCAAACAGACCTGAAATGAGTATTAAA
GGCCCCCTTTATTTTTAAACTTTTACTAAAACAAGATGGATTTCCCTATGTTATATAATGGTGAATTTTA
GGCATAAATAACGTTTTTTGAGTGTTGCATAATTGTACGTATTAATGTAATGTAACTGTGGTTAACGAAG
AATTCATCAAGGATATCACTGTTTTGTGGCATTTTTTTTTTCCTCCTCTAATCTTTGGACTTGTGAAATA
ATTTCACTATGAAATAAATGTTGGTTCTTGTCATATTCTAAGGGAGATTGATGTAAGTGGCTCCACTCCA
GCTTACAGAAGGTAAACCACGACCTTTTTGCGTTCTCTGAAAACGCTTGTCTTCCGATGCCTCTGTTTCT
AAGACTGACAAGCACTCTGGGGGCACTGTGACGCCTGCTTCTAGCGGCAGAGTTGCTGCAGCTCCTGTCC
TGGCTGTGAACATTGTTCTCTCTCTGGTGTCTCTATGTTCATAACTACAGAGACTTCAGCTCTATTCCAT
TTCATATTTGTGCTGAATAATCATTCCATTTTATGGGAGAAAACACAAGATGTAAAAGCAACAAGTGACC
CATCCTTTGAAGCTTACAAGAAGAGAAACATTAATCTATTTCACGTCTTGAAAACAGATCAGTTTTATTT
TGCTCAAAAAGGGCACATGTACATTTTTGATCTAGGTCTTAGAAACGTAGAGTTTCAGAGGATCAGCATT
ATACACACTGTCACACACACACACACTTAAAATTCAGATGAGGAACAAGATAGGAATGAGGTTTTGTTAG
GGACGCAGAGCACCTAAAACCAAAGGATATCGACAGTAACAAAGCTGTTTTTACTGTAGTGCTGACTGAA
CACTCATGCTGGTGTCTTCATGTGGACCATGGCTTTCTTGTATTTCTTTGCAGTTTAATAAATGACTTCA
TATCTCAGGTTACCTTTCCACATCTCCTGGAATATATGTTTATGTCCTTAAAGTTTCAGTGTCGTCACTT
TAGTAGCTTTAGTTTGAGTTTTTAAATGTTTGGTAATATTCCAACAAATATTTTTTAAGACATTATGAAA
CCTTATGAAGTGCCATATATTACAAGTGAGATAAAACAGCAAGCAAAAGAAGGTTTGCAGAAGGTTTTTA
AGTGGCGAAGTGCGGGCCTGCCCATTTTGGTGTCTCCTTGGTGGTTACTCCTGAGAAGGGCCTGGAGGAA
GAGCAACTGAGGCCTAATCTACAGGCAACTGCCAAATTGTTTCAGTTGACGTTTTTCCCTCTCATGTTTG
ACTATAATAAATAGGTAGTTGCCAGTGGAGCCTTCAGCCAACCACCTGGTAATAAACTGTTAAAAATGGT
GCAAACCCTAGGTCACAGGTGTGGGGGCCATTTGTCTTGCCTGTTAACAGGCCTGGCCTTAATTCTTTTC
TCCCATGGCCATTTCTGCCTTTGGGGAACTCACAATTCCTGTTGACTAAAAGAGCACCCTTTTCCACCAC
AAGCCTGACAAATCAGACGTCCACATAATTTCTGAACTCGTTTTGGTTAGGACAGGAAGCACAGGCTCCC
TTCCTGTCTGTGTTTTCCTAAGAGAAAACGGTCTTCCCTCCTTTTTTGCATATTTGGCAAGTGGTTCCAC
CTTTCTCTGCACCCTGGTGGAGTGTGAAGGCAGCAGAGGAACCTTTTGGAGGAGGAAGAGGACACAGAGG
CCCTGTAGCCAGGCACCAAGATCCCTCCCAGGTGGCTGGGTCTGAGGGGAACTCCGAGCAGCCCTAGGTC
CTCAAAGTCTGGATTTGTGTGGAAAAGGCAGCTCTCACTTGGCCTTGGCGAGGCCTCGGTTGGTTGGTGA
GTGCCACACGGTTTCTTTGTGTGCTTGCATGGATTGGAATAGCCATTGTGTTCTTCCGTCTTCCCTGCTG
GTGTTTCCACAGTGGGTGGCCTGAGCCCAGAGCAGCTCCCCATATCCCTGTGCAGGCCACCTGTCTCGGG
TGATGGAGAGCATCATTATGCTCCGTCTGAACGCTCTGCTTTCGGATGGCCCCATGCTCCACCTCCTGAT
AGCTCGTGGCGCGGGGCCACGGCTTAACAAATGGCTGAAAATGGGTCCTAATTAGTGGAAAAGTGCTTTC
TTCATATTTTCTCACTCGAGTGTGCAGTGATTCATTTTTCTTCTGCAATCAGCTCACTGCTAAAGTAAAT
CTGACTCTCTTCCCGCCATTGCACACCAAAAGTTAACTCTAATGGGTAGGAGGTTAGGTTTGTTGAGAGA
GCAATGCAGTAAAAAGAGGGGATCCAATGTGGTCTTGTCTGTCTGGTCTTCCTTTCTTCGTTTTTTCCTC
CCTTGTCTTCTCTGTCATTCCCTTCCCTCCATTTGCCTTGCCTTTCCTGTCCTTCCCTTCCCTTCCTTCC
CCTCTTTCTTTCTATAATTGGTGGGGGGTTTGCACAGACTGCCAAAACACTAAGAACTGTGTAAAGTGTT
TTTGAATGGCCTTACACATATTGAAGTAGATTTTTATGCTCCATTTTTGAGATCACACACTAAAATCTAT
ACCTTTAAAGCATTTTCTGTTAGTTTGAAACTATTTGAAAATGAACAATGTGGTTTAGATTAGAGTCCTG
TTCTGAAGCTAGGAGTTCCACTATGAATATTGATTTATCAGTTTTTGACAAATTTTTGTTGTTATACCAG
ATTTTCACTGGCAAACCTAGAGCAAATAAAATTCCACATAAGATACTTCCCTAGACCTAATGGGAAAAAT
GTTTAATTTAGAGTCTTTAGGAGAAATGAGAATGAGGAATTGACCTTTTGTAAGCTTACTTCTGAGGCAC
TCTGAAGTGTGTTCCAGTGCTTTTAATGGAAACTAGAGAGAGCCAGCAACCCCCTAGTGTGAGCCCCACT
TTTAACCGGAAAAAGTGACCTTTTCCTCCTCCTTTGTGCTGAGTTTTGCGTAGGGCAGAAAATTAAGCTG
ATATTCAAAGAGATTCACTGCAAAAACATATTGATAAATCGTATATTCTATTTCATTAAATTAAAACCAT
ACTGCTAATTATCTCAGGTTGTTAAACATAAGGCAATTAATTATCATTTTAAAAGTTGGTAGGAAGTTGT
GAGTACTTTTGCAGTATGAGTGTTTTCCCGCTTTAGTATGAGGTTGTGTATGTTTGCTTGAATTTACAGA
ATTTTCACTTTAAGAGCAGACAATGTTTTGTTAAAGAAATGAAATTTGCTAAAAAGGAGCATGTAAAGTG
AAACATTAAAAATAAATAATTTCAACTTACTTAAGAGCTGCAGAAAAATCTGATTGCTGTGTTTAAAATG
AATTTTCCCACATTTCGCTCTCTTATGGACAGGAGCATTTTCTGTCAGGTTATAAATAAAGACATGCCCA
TTTTTTGTACCCCCACAAATGAGGAAGTTGTAAGCTCTCTGAGGTTTTACTGATGAGCCCCCTCCCCCTG
GGTTTGCATGAAGAGATCATAGGCCACAAATAAAGGACTACAAAATGGGGTCTAAACTATCCTGGTGGGG
CCTGATACCCACGTTTCGCATGGACCTTACGATGTGATGAATGGTTTTGGCATGAGTGTCTTAAGAATGC
TTCCAGATTCGGGTTACAGGACAGCCAGCGCTGAGCTCCCTATTGCAGAACAAAGTAGGAATCTAGAACT
TTCTTGCTAACAGGATCCAGCTAAAACACCAAGTTAGATTCTTAAATGATGTTCTTTTCTGTCATTATTT
GATTGTTGTCAGTAGCAGTAATTGTTACCAAGCCATTGATGCTTCTATTCTTCCCTTTGCCCTTCTGAGA
CACAGCTCATTTTGACTTCAGTGGAACCCCTCGAAGGTGGGGTGATGAGCAAGGTGAATTTTCAAAGTAA
AGCTACTAAGAGACCAAACTACAATTTAAGGAACCTGATTTTTGAATCAAATTCCATATACTGTGGGTAT
AGTTCAACATAGATTAATTTCTTATAGTTATTATGAAAAAAATCTCATCTTGATGATAGCTGATAATTTT
GTGGGTGTCGTAAACAAAACAGAGGTCAGAATTCAGTCCCTTGGGGAAAATTTCCAATTAGTAGGAAACC
AAGTGGCCTACCTTAGTTTGAAGACACCCATCAGGATGTCTGCACCTTTTCATCCTCTCTGGAGGAAAGA
CTAAATACCCATTATTGTATATAGGTCAGGCCAAAGCAGCCTTTTATATTGCAAGGAATAAGAGGTAAAT
AGATATATGTGCAACAATGAATCCCCTAATGTGTTTACTCTAGAACACATGTTCTTTCTGTATTTATATG
TAGATTTTGTAGATCTTGTCTTACCACCTGCTAATGGTAGATACTGTATCTAAATAAGTTGAGGAAAATT
TATAGTACCTAGGAATGTGTCCTCAGTGGGCCAATCAATCAATCATGACTTCAGGTTATTTTTAATAAAT
ATACACGTATGGGTTCATAAACAATGGGATGTTCTTGTGAAGATCTAAATAATTTTACTTCTTTGGGACT
AAATAAAATATAGCTTTTGCCAAATAAACTCACACAAGCACTTATTTTAATAGAAGTCAAATGGCTTTGC
AGAAACTTCAGTTTTACAGGTGCATTGTTTGAAATGTTACGGGTATACAAGTGGATTTCTCTATTATGTA
CAGTGTTAAGTTTGAGTTTCAAAATGTCCACCTGAAATGATTTACTTGTACGTTAAGATAATTTAACTGC
TAAGAAGGCAAGATAAAGCATTCTTTGTGACACCATATGGCCTTGCTGAGGGAAAAACTTACTGTTATAA
GTTTGTGTTTATCTCTCTTTTTAAAAAAAAATGAAGAAAAAAACGTTTAAAATAATGGGAACACAGCAGT
TCCTGGGGTCCTCTGTCTCTTTATCTTATTATAGTAAATTACCAAAAAAATAATGACCTGGGGCATGTCT
GTGTGGACCCTTCTTTTAGAGGCAGTTTCTGTGTTTTGTAAAGCTGTAGGTTCTATTTTCATTGCACTTC
ATATTGCTGCACAGCTCCTGACCATGCATGAAGGTCCTCTGAAATCGGTAAGAGGGCAGAAGAAAATGAT
TCTAAACTTAGATTTTTTTAACTTAAGTGATGAAGTGTGAAACGCCATTTATATTTGAGGAAGCTACCTA
GGAAGTGGCTCATGTCGATGGCCCAAATCAGAAGAGGGCCTGTAAAAGCTTCTATCAATTTTGACTGTGT
ATGCTTCTACCATGGCGGCTCAATAAACAGCAGTATTAGTTTAAGAGTGGATGGTACAGTAGTATAGACG
GGAAGCCTCTCCTCTCCGTGTGAACCGTGCACCCCTATGAGAGGGTAGAGACAATACAATATGCCTGTAA
CGTCAGGACAGACAGTCATGGCCAGCTTGAACTCCAGCCCTGGGCTTCTTGCAGCAACAAACGTGAACAC
AGAGGACTGTCTCCAACTCCACTTTCTCTATTTTTAAAACAACTTTTTGAATACAGTATCTGCCATCTTT
TCTTATACCTCACTTTGAAACAGGTGGCTCCACTGTGGCATTTAAAATGTTCTGTTTCTTTTCCCTCTGT
ATCAAATACCTCTTTACCAAGAAAACATTCAAACAGCATAGTTTTTAACTGTATTTTGAAAGGTTTCCTT
AGTTCCCTTTGACCCTTCCTCTTTTGCATATCAGTTCCTGGCCATAAAAATAAAAAATGCTAGGACAGAA
TTGCACATCTGAGCTGATTTGCCCTCAAAAAGTTTCACAGTGGAACAAACCGCAGGAGGAGTTTTCTGTG
GCTCAGTTAAATGTCGGGGGAGGGTGGTGTGAAAGCCAAATTGGATTCCTGCTTTCCTGTTTAAATCTTG
TTTTTCATTGTTATTTGCACCAGCAATACTCTGTGGAATAATCATGAAAATGTGTAGATTGGCAGCTAAT
TTTTGAAAAATGAAAAGAATCAGAAATGAAATAAGAGTGCTCGGAAGTTTTTATGTTCTCTCAACCTGTT
TTGTCAAATTGTTACGAAAACCTATAAGGTCTCTTTGACTAGATACAAAGACTTTGCACATTGCCTTAGC
TTTCTCTTGAAGCATTTCCTTTTTTAAAATACAGTGTAATTCACAGTGATATGATAGATTTGCAAAAGTA
AAATCTACCAGTCTGAAGATGAAAGGACTTGTCTCTTAGCAGGAATAATGGGTTTTATTAAAGAGGTCTG
TGACCTAAGGCATTTTAAATAAATTACAGGCTTGGTCCCTGTCTCCCCCATGTATCTACTCCCTTCAATA
TAAGCATCATTGAGTATTTAAGGAAATAACCCCAAATGTAACTCTAGTGTAGCTTCACTTGTCAGGGAGG
AAAAAGTAAATAGCATACATTTGGCCAAATAACCAGAACTTTACTGTAGAAGTTTTATGATGAAATTTGC
CTTTAGTGCAGAGTATTACAAAGATCATGTTTAGTTTCTAGCAGTATATAAGTAGCATCCATCCTTATCT
GTCATGCATTTGGAGTGTGCGACCCCTGCACTGGGCTGCAACATTCTGATGGGCAAGAGTGCTAGGGAGA
AAGAGGCATCACCATCAGACTGCACGGGTTCAAGTGTCAGCTCTGTGGTTGATTAGCTGTGTGACCTGGG
GAAAGCTATTTCTCTTAGCCTTGGTTCTCTCATCTATAAAATGGAGATAATGATGCAGATGCCTTGGGTT
TAATTGGGAGAGTTAAAGACACATTTACATATTTAGCAAGTAGGTGTTGAATTCTAGCTCTACATTGGAC
ACTATGCCAGGTGCTCAAATAAACAAGTGGACAAGACAGACAACACCCATGGTCTTATGAGGCTTAACCA
TTTGCCTCTTCAATGCCAGAAACTTAGTAGGTTGATTAGATAAAGCCAGTGAGTACCAGTATCCTTTTCT
TTGCAGCCTTTTCCTGGCACACTAAAAATACTCAGTACATATGAAATATCACTGGACAAAGAATCCCCCT
TAGAGTACCAGTGGAGAAGGAAGGCATTTGCTTAAAAGCAAACCAACAGAAAGACATTGTAAGGCAGTTG
TTTAAGTCTCAGAGACCTATAATTTTTTTCTTTTTTCTTTTTTTTCATCTCGCTCTGTCGCCCAGGCTGG
AGTGCAGTGGCACAATCTCAGCTCACTGCAAGCTCCACCTTCCGGGTTCATGCCATTCTTCTGCCTCAGC
CTCCCAAGTAGCAGAGACTACAGGCGCCCGCCACCACACCTGGCTAATTTTTTGTATTTTTAGTGGAGAC
GGGGTTTCGCCGTGTTAGCCAGGATGGTCTTGATCTCCTGACCTCATGATCCGCCTGCCTCGGCCTCCCA
AAGTGCTGGGATTACTGGCATGAGCCACCACGCCCGGCAACTACAATTGTTCTTAAAGCTTGTAGAATTA
CTGTGTGCTACCAACAGACAGGCTAATTTTGAGTGACCCTCAGTACTTTGTACAGTTAATTTGGCACGCT
GTGTACTTAGTGGCTTTTTAACAGCTATAAATTTGGGCTGCTAGAAAAGTAGTAAAGTTGTGATTCTTGA
CAGGCATCTATCTGCATTTTCATTTTTACTTCATTTGTCTAGACTCAGCTTGTCAGAATTATGGAAGAGA
CTCCTTGTGTCAGGGCAAGCACTGTGAAGAGAGGTATTCACTGTCAGAAAAGAGAGGGGAGCTGGAGGCA
GCTCAGAGGCCTGAGACCCGCCTCCACAGGAGCCCCAGCAGGTTCGGTGGAGCTCTGGCCACACTCTCCT
TTGGGATGCTGAAGTCAGAATGAGTTCACTTCCCAGCCAGTCTTGCCAAGGCTCCTCACCTGGAAGCAGC
AACTGCCCAGGGCTGTTGGATGTTTCTCCCCAGGGGACAGCCAGGTCCCAGTCCCGCCTCGGTGTGGAAG
GAGGAAAGGCAGGGTCCAGGAAGCTGTTTCAGGACAGGCCCAAGGTCCCCCAGGGATGCCTTTCAGGGTC
AGCGGAGGCTGTAAATCAGCAGGGCCCACACGGCCTGGAAGAGGCCCCTGTGCTGTCGGCTTGCCCGGCT
TGCCCGGCTCCTAGTCCGGCTTCTGCTCCTCCTTTGTAAAGTTATGGATATGCTAATAGTTTCCAACTGA
GACTAGGAAAGTAAGTCCTACTTGACACTGTTTGGTCAGAAAGAGGGAGAGAAAGGAGAAGGACAGAGAG
AGACTGAGAGAGAGACAGTCTCAGACAAAGGGAGACGGAGGGAGGGAGGGAGAGACAGAGAAAGAGATGG
GAGGTAGGTGTGGGAGGAGGGAGAGATGCAGAAGGCAGAGGAAAGACAGACAGAGATTTAGACCTCCCAA
GTCAGTGAGCAGTCCAGAGTTGGAGTGGAGGGTGCCTGGTGGCTTGTGACTGCAGACTCCACTCCCCGCT
CCTAGAGGCACAGCCATGGACAGCTTCTGTCACGTTGGCCCTGCACTTATCTCTGCATCTATTTCCCCTT
GTGCAAGATTCAGAACTGCATGCTCCAAAAAAACAATAAAAGCATTCATGTTCATAAGAATTGCACAGGT
AAAAGGTAGTTTGCTGATATTGTTGTATTTTTTACTATCGCTTCTTTTAGGTCTTGCCTGAAATTGTTTG
GGTTTCCCAGGCAAAGTAGAAAACTGCGGTACGTTTCTGTGAAATAATTATTCCTTCTGGCATCTCCCTT
TACAGACCTACTGATCTTGATTTTTCATTTAGGTGAAAGTTTGTGAAAACATGCCATTAGCTTGCTTTGT
GATTAACTCCTTTTACTGAATGTGAGCTCCTTTTAAATTGAGGCCATATCAAGCTTAAATTCCATATTTT
ACCCGGCACTCTGCATTTCTTCCATGTGGGAGAGGAGGGGCTCAGTAAGTGCTTTGTAAAATACACAGCC
GAAGTGATGCACGTGCTAACAAAGGAGTGTGACAGGACTTAAGTGCCCTTCTAGACACTTCAGGCTCCCC
TTTGTAAGCTGTCTTGGAAGAGGCCACATTTCCTTTCCCTCAAACAGTTTCTCATTGTTTGATTATTCTT
TTAGCCTTTCTCTGGAAGCAAAGCCACTTTTACGAGAAAGTCACTGCTTTTTCATCTCAAGAGATGCAAG
TTTGGAGTTTGGGGAAGTTTTCAGGTGCCCGTCAAGTCATCCTTTATGATGTCAGACGAGTCAGGCCACA
GAATTCACAGGGCTCAGTGCAGACCGAAAACTTGAGGCCTCTTGTTCAGAAATTATTAAAAATTTTGGTG
AACATCACCCCAAGCAAAGAGATCCCCTAAGCACCAGCCCCCAAGCAACTGCACTCATAAGCCCATGAAG
CCCCCTGCTGTCAGAAACAATGTGGTTGAAATTGTGTATGCACTTGGAAGTGAGATGGATTGCAAAACAC
AGGTCTCCATGCTGGGGCAGGAGTGGTGATAGGGCATGGAGTGGAAATGTCCAGCAGGCCCACGTGCGAA
AATGCAGAGCTCTCTGGCTCTTGCAGACTTGGCTGCTGACAATAGACGCGCTCCAGGAAGGTGCTCGCTG
TGGTGTGATCTGCTGCCCACCCCTAGCTCCCTCCAGGAGACTGGTGCGGGGACTGTTTGCAAATGACTGC
AAAAGTAAGAAGGTTCCCACAGAGCAGAGCTTGATTTGGGGACCAGCCGAGGGCAGTTTGTCAGGATTCC
GGCTTGAAACTGTTCTCACATCTCACCGCCTGAAAGGACGAGTGTGTCCAGAGGACTTAGCATTGATCAC
CTCTGTCTCCATGCAGCAAACTCAGAGGCTCAGCCCGCATTCCACTGGAAGGGCGTTTGCCAGTGGTGTT
GGTTGGAAGAGCCTTGACTTTGCCTTAGGAAACATCTTTTTTTAAGAATTGAAAATAACTTGAGTATGCA
ACAGTAGGGCATTTGTTATATAAATTAGTTGACTAGTGTGTAGCCAGTAAAATGATGATGGTGGTGTGTA
TTTGTTAAATAAAAAGATATGTGTGGTATTAAATTAAAAAATATTTTAAAACAACATATTTGTAATCTGT
TTAGTGTCCTCTTTTTGTAAAAAGTACAGAAATAAATATACAGAAAAAATAGTAGTCCTAAGTGGTAGAA
ATTATGAGCATTTTCTTGCCTTTAAAAAAAGTTGTAAAAGATTGTATCATTTATGTAGCAAAAAGTTTTA
AGTCAGCATTCTAAAAATTTCGTGTTGTTATAGTTGCTGTGACAAGATTTAACTTCTGTATGCTTCACCA
ATCAATACAGAGGTATTTAAGACCCGGTGTGTGATAGGCCGCGCTAAAATACTATACACATCTTCAGAAA
ACTAGAGAACTAACTTCTAACTTCCTATATTAGTGTGGCACGGCTGTTACAAAGATTTTTCTCATTTGAG
TCTATCTTGCTTCTTTATCATTGTTTTGACAGTTTCAGAAGAATCGTGGCTTTTCCCCTTTTTTACAGTA
AAGGTACCTGAGACTCTTGACGTATTGCTTTTTGGAAATGCTTGTGCTGGTCACATGCTTGCATCTGGGC
TAGTGTGTCTGGCTTCCGTGTGCTGGTGGATGCTTACTCTGTTTTCTGAAATACTTTTTCTGTACAGTGG
CCACTAGCTGTACTCCTAAGCCACACACCTACCTTGAAAATTCATGTCACTTTTAGAAATAGATAAAAGC
CCCTCCCATCCAGAAAAAGTGACTATCATGTATATCCTCATCATGACTAATACTGATATTCCTGAAATTG
AAAATACATATTCCATATGTACCATAAAAGGTATTAAAGATATATGGAGTGATAGATATATTATATATAA
CACTTCTACCCTCACAGTTTTCAGCCTAATTGAGAGGGTAAGATCCCTGAATCATCCATCAGTTTTTCAG
GTCTCTGCTGAAAGCAGGCCACAGCTCAGATCCACACATCTGAACCAGAGACAGAGGTGGCCAAAAATAA
AAAGGGGGACAGGGGGACAACCTGGTTTAGAGTCAACAAATAGACTGCATTTTCTGGTTAGTGAAGGAGC
TCTCCTGAAAGTCATATACCAGAGCATAAATGAGCAGATTTCCTTGAGGTCACCTTCTGCTGGCCATAGC
TTTCTTATCTGTGGAGCTGCCAGCTGTCATCCACTTTGGGGCACCTGAGACTGCCGAGCGGCAGGCCAGG
ACCCAAGTGCGAAAACACAGAACACCTTTTTGTTTCTACTCCACTGATGCTGGGGTTCTCTCCCTGGTGT
TTGTGGCTCGTAGTACACTCTGTGGAACATTCACTATGGTCATCGAAGGGCAGCATCTTCCCAGTTGTTT
CTTTCTTTTCTTTTTTTTTTTTAATTTAAACCGATCTGAGAAGCCAGCCATCTGTCAGCAAAACAGGAAG
GCTCGGGCTGTCTCCTGGGCTCGTTTTGCTGCCGTAGTGAGCGTCACTTCTCCCCGTGTAAGAGTGCTGG
TGAAGGCTGAGGCAAGGGCCCAGAAAGATTGAGGGACAAAGACAGGAGCGCCCGCATTGCCCATCTGCCA
GGCTGGAGGTGTATTCATTATTGATGGAGGTAGTGCAGTTGCTGCTCAGATATGCAGCCCTGCCTGGGTA
AATGAGACATTCTTCAGCAAATTGCTTCGTTTTTTGATTGCTGATTGTACGCGTGTCACCAAGCTGACTC
AAGGTTCATCGATGCATGCTCAGTAAATTAGAAAGAACATAACTATGGATCAGCCAAGAGAATGAATTCT
GTGCCTACAATGACCCAGGGCCATTTAATTTTCTGCTTAATTTTGTTGCAGTCAGTTTGCATTTTGGGTT
ATTATGCAGTAGGAAATTAACAATAAATAACAAATTTGGTCCTCCTGTGCTTGTAATGATATTTTTATAA
ATCTTTGTAATGCTGTTTTTAAAAGGATCAAGGTCTGTGCCAGTCTGATACTCCAGCAAGTATGTGAGGA
GGAAAATGCATTATTCTTGCTAGATAACCTTGTTGTTAAATAGCATAGGGGTTCTTTATCTCTCTCTCTT
TCTCATATCTTATTAGTATTTTTGCTTTAAACTAAAATCCCTTCCTCTCTTTCTCAGATAACCTGAGGAC
CATGGATGCTGATGAGGGTCAAGACATGTCCCAAGTTTCAGGTGAGACCTTATGAGATAGCTGTGTGGGA
AGTTCATGAGAAAAGCTTCCCTGGGGCCGGAAGTCACAGTGCTTGGTATGCTCATGGGGGAGGAATAGGG
GCTATTCTGCAAAAGAAAAGACCATGATGGAATTTGCCTGAGTGTTTCCTTCACCTGTTACAAATTATCT
CACTTTGAGCTGAACAGAAAGCCTCCAAGATGAAATTAGTTTTACTGTTAAACTTCAGGAAAAAAAAACG
GGAAGAGTTAAATACATTTTTGTACTGTTGGAAGGAAAAATGGCTGATTGGTTTAAAACCCAAACACATG
CCAATGATGGTACTTAAAGAGAGAGAGAGAGAGAAGCTTGAAAAACATAATTGTTGGGCACAGTCATGAC
TGTTTGTTCATTAAGCATGGACACAACATTGCTCCCCTTTGCCATATATCTTTTCAAGCCGTATTGGATA
TAGCTCTTCTCATCCAGGAGACCCAGGAAGTGGAGAAGTCTGTAGTAGGAAAAGCCTAAGGGTAGGTCAC
AGACTGTGACCATTTGGCAGCACTGAGGGTGGACGGCGAGCCAGTCCAACAAAACCGCACAGTTCCCCAG
TGCATGGACATAGGAAGACAGCTTTCTATCTGGCCCTGTATCCAGAGGCGTCAGCCCCAGTAGCAGCTTT
CATGGACTTTGGGGTTTTCGGTATTTCATATTTTTGAGCCTCACAGACTCACAGCCAGCCCCAGAGGCTG
ACTTATATTTGAGAAAGTTCTCAGTGGCACCTTGCCTTGGCTGAGCGCCCTCGTGTTTTGAAGTTTCTAT
GGGATTCTACAAGTTGGTGCTCCTGATGAAGACCAGGACCTATGTGTGGCTGCTCCCCTGCTTGGTGGTT
TCCCTGGGGAAGGTGCAGGAGAGGATCTTCTGAGTTCCATGGAACTGGAGATAGATCTGCCAATCACAGG
CTTCCTTCTCCACCACTCCTCAGCCGCTCTATTCATGTTTCAGATTTTGGACTTAAACTCTCCCAGGTGC
AAAGAACAAACAAAAGGCTAGCTTATTTTTCTTTTAGAGTGAGGCTTCGTATTTATTACAATATAATTGC
CACATTCTTTGTGTAATTCTCACATTTATATCTTAAATATAATTCTCATGAATGAGAATTATATAATTCT
CTTTTTGTATATCATTGAATATTTTCACTTAATTTTTAATTTTTTTAATCGTCACAAAATAATTGTGTAC
ATAGACACAAAATAATTGGGTACATAGTGATGTTGTGATATATACAATGTATAGTAATCGGATCAGGTAA
ATCAGCATATTCATCATCTCAAACATTTATCGTTTCTTTGTATTAGGAACATTCGACATCTTCCTTCTAG
CTATTTGAAACTATATATTATTGTTGACTACAGTCATCCTGCAATGGTGTAGAACACTAGAACTTATTCT
TCCTACCTAGCTGTAATTTTGTCTCCTTTAACAAATCTCTCCCTATCTTCCACTCCCCCGACCTTTCCAG
CCTCTATTAGCCTCTGTCCTACTTTCTACTTATAATGATGACAGCAGCATTTGTTAGTTTCCACATGTGA
GTGAGAACATGTGGCTTTTTAACTTTTAGAATGTGGTATTCAGGCACTTCATGGTACAGTTGGTAAAAGT
GAAAATGTGTCCAAAAGTTTGTGATTATCTATATAAACAAAAATGGTATAAATACAAATATCAATTTTGC
ATTGAAGAACTTACCTTAGAGGTATATTCTCACAAGTGCACAGAGCATTTAAGCATTTGTTCACTGCAGC
ATTGTTATCAGTATTTTAAAACTATGGTACATCCATGTACTTCCACATACAGCTCTTAAAAATAAGGAGG
ATATGAATGAACTAGTATGAAAAGAAGTCCAAATACATGTGAAAGTGAGAATAGCATGGTTCTGGATGGT
ATGCAAAGTATGATCTCGTTCTTTTAAAAGAAAATAAATTACATACACATACATATTTTCTATATGCTTG
CCCATAACGTTTAGGAAAATTCTTGGGTGATATTTATTAACCTGGACTTCCTCTTGGAAGACTGATGGTA
GAAGGAAGGGGACGAGTTAGGGAAGAGGAGGAGAAGGAAAACTTTGCTTTTCATCTTCTACCTTTTAGCA
TTATTTGAATTTATTTTCCTTAAGCGTTTACTTTGTTTCGTAAACAAAAAAGCACAAAAACAAAAAACGA
GTTAAATGGGAAAAAAAGCAGTTTAGCTCTTTATAGCCTCTCATTTGGCTTCGCCAGCCTCTCACTGCAG
CCTCAGAGAGCTGGTCTGGGAAACACTGGTAGATGAGGACTGTAATCCTCACTCATGGAAGAGGATCTCA
TTCACTGGGTTTGCTGACTGTGACTAGAAGTGATTAGGGTGTCAAAAAACCCAAGCATGTTAAAAATTTC
CAGAGGCCAAAAAGATGCTTTCATTGTTCTGCTCTTCTTTTCCTTGTCGCTTTCACTTTGGGTAGCTTCT
AAATTGGTATTTTGCATGGTGCATTTAAAGAAAATGAGACCCCTTTGGCCAATGCAGGAGTCTACACTCT
GATATTCTAGAGTCAAAGCTGAATGCTGACACCTAGGAATTCATCTCTAGAATGTTTATATAAGGAATAG
CCCCTCAGTATTCCGATCTCGTATCTTAGTAACGAAACTAACAAAAGCCTGATTCTCCTCTGGTAGTTTT
CTTGTCTTTACCATAATACAAAATAAGTAATTTGTTCTGCACCCTGACTGTTCAAAGGATAGGGTAGCTG
GGGGCGGGGACAAGAATGGAGACCTTATTACATAAGACTTCCTGAAAAAGGAAACTCTGTTTTTGTTTGA
AATGATTTGGTCTGAAATTTAGTTTGTGTACACTTACCAAAGGGATTCCTATTTCTAAAACACTCATACT
GCTTTTGATTCCTGTTAACCTTTGAGCACTCTACGTAATGATGAGAGCACTTAAAGAGTCATGTCACTTT
TAGTAAAGAATCAAAGGATACTTTTTCTACTTCTTCGAGTTTGATCTCTGCTTCTCCAGTTAAAACCAGT
ATTTGTTTTTTTCATTTCTAAAGTTGGAAGAAATGACAGTTAGTTATGGCATAAGGATGTACATTTAACC
AAATAGGAGTTGACATTCTTGGTAAGAAATCTTACCAAGATTATGTTATAGATTATAAGAAATCTTAACA
AGAATATGTTCCTAAATCATCCTCTTTTCCCATAAAATATTAAAGTATCAGCAATTTCATAGGATTCAAC
CTAATGTATGCGAAATGCTAGATAAACAGATAAATACTTAATATCTGGCTTTTTTTCAAAGCACTGGGTT
ATTTGTTCCTTGAGATTTATCCTAAATGTGGGCTATACCCTGGTTTACAGTGTCTCACAGATGTGTAGTA
GTAGACACTCCATAAGTGTTTACTGACTTGAATCCACAGGGTACTGAGAAAATGCTACTGATAGACTTGG
AGGAGAGCATATCTAAAGCAAGCTACCCTTTCCTTTAGGGCACGTCTCACTAATTCTTTGGGTAAAGCGT
ATTTTTCTTCCTTTTGTGTTTTTGGCAGTCTTTCCAAAAATACGTGTTATACCTATGCATTATTTTTTGG
TTTGGTTTCTAAAGAAAGAGTCAGCCGGTGGGAAAGTGAAGGATGTGGGAACTGAGAGATCTGCATCAGC
ATCCCACCTCTACCTCCCACGATGGGACCTGAGACAGTTATTTTTGCCTCCTGGACCACTATAGTATCAT
CTGTAACAGGAGGGACTTGAGCCAGTTGATCTCTAAGGTTCCTCTGGCACCTGTGACCCTAAATAGATAT
TGGATATTGGTTTAATGCTATTTGTAGTGTGTTTTTTTGGGGATATGGAAACCAGAAGTTTGTTTCCATA
AACATAAACATAAACTGTATATATCTAAAGGATATGGAAACCTTTAGATATATATAATCTGCTTACGTAA
AGAAGGTTTGTATATATTGCAGTGTCAATGGGAATATTTTATCAAGTTAAGCATAGTAAATCACATTGAT
TAAATGCTTTGTATTTACCAAACATTACCCAAAGTGTTTTCTCCTTTCAACCTCACAAGGACCCACAGAA
GAAAATACAGTTATCATTTCCAACCTGCAGGGAGCTGAGACACAGAGAATTTAAGCAACTGACCGGAAGT
CCAACAGGGAGTCAGAGATTGCTCTGGGGTGTGATCCCCACTTGGACCCTAGAGTGGAAGCTTCTCCACT
ACTTTATAGAGTTGAGATTCTATATTTTGAGCTTGTATTTACCCAGAGAATTATATCCTCTTGGGCAATT
GTGTATAATAAAACCTCATGCATTTAGGAGAGGCGGGATGACAGAACTTTGTTGAGTGAATTATAATCTA
CTTGAGAAATTATTTGCTTACATTTTATAAGCTAATTATACCATATCTCATCCAGTTTTCCCAGAACACT
TCTCATAGGTAATGCTTTATTTGAAACATAGGCCATAGGTAAGTTAAGTGTAAATGTGTATTTTTATAAT
TTAACCAGAAGTTTATTTCATTTTTCTAAATAAGTGAAATTGTATTGCATCTTCTAAATTATTCTATTTA
AACACTTGATGTCTTGCTGTCTCCGTCTCTGTGTGTTTGCATGTCATTGTACATGTTCTTAGGAAAAGTG
TGGGAGCTTGACGCAATATATACCTTATGTTTCTATGTGCATATAGTTTACCAAATAATACCATAAGTTT
ACTTAGCATATTAGAATCCATGCACATTATTTTTATTTTATCTTCACCGCAACCCTGTGGGATAGACCAA
AATCATGCTTTTCAGCCTCCTTTTTCCACTTGAGGAAAGGAGTCTTAAAAAAGGGACCAGTCTCATGTTC
CCATTCGTCTTACAACTAATTGGTCAAGCCAGAAAGCCAGAACTATGTCCTGGGTCACTAACTCCTAGTC
ACTGTGTGTTAGTATTTGAGATGCCTGTTGGCTTGATTTAGTCATTTATTTTTTAGTGTTTTATAATCCT
TGCATACTTTTACATTTTAAATGGTTAACCAGGCAAATTGGTTTAAAATCAGTGCATAAAAATACTGTGC
CTATCATGATGGGTTTCATGAAGTGATAACTTTTCATCATGGAGATCCTCAGCTGTCACAGAAGATGAGG
GGCCCTGGGTACAGAGGCTCACGTGAGGGATGAAAGTCTCAGCAGCCCGGACTTACACTTTGGGGCTTTT
AGGCAAATCAGACAACCTCTTAAGAACTATCACTGAGTTCAGGCAAGGCGAGCTTGAATTAACACAGGGC
CCTTGGTGGGCATGTGAATATATCTCACTTCACTACCATCCAGTTCTGACTCTTTACTAGATGCCCCTGT
ACATACCAAGACTGATTTTTTATTCTCCCTTCTCCCCATGTGGTTTCTTCTGCATAGAGAGTTCCTATTG
ATCAGTCTGACCCATGGTATTTTAGAATTGCGATCCCTACTGTTTCATTATTCCTTTTTCTCCCCCATGT
TGAAAAAAATAAATGTCCTGAGATGCAAGATCAGGGACACTGGAGCACTGACATTTAGTTCAGTGCAGGA
ACTGAAGGCAGATGTAATTCTTAAGAAGCGTACCTGTTATTATGAACCATCCTCAACAAATTGTAGTGGA
TCTTGTTTTCTCATAGATACAGCAGTTAAATTTTTTAATAAAAGTAACTAAGAGTTATTTGGATGTATTT
TAGCATGCACTGAGCGGAAAGTACGACATTTCTTCATTGGGTAAGTCCTGATTCTTTATGATCCTCACTT
GGTTCCAGGGCCCCATGCATCTAAGGGTGTCTCAGAGCATCCTGCAGTGCTCCAGCATGATCGCAGGGAA
AAGCTATAGGAGGAAAAGAGTCAATAAAGTTTAGTTTCTCAACCTCCCACCTCCACCCCATAATAATGAC
AGCTGGTTAATCATGAGACGCGTGCACACCCCACACGCCCTGTACATGTTTACTCATTGGGATAGCATGT
CAGGCCAGAAGGCTCCATGGTCATTTCTATGAAGGTACTTTAGCAGGTCTTCAAGAAGGCAAGTGGCCTG
GGTCCCTGCCTCCCCAAATTGCAAGCTCCCTGCTTTATGTAGGAGACCTATGTGTATATTACAGTTCTGT
GTAAGATTATTTTGTTATTCTTACCCCCACACCCACCCCCCAACCCCCCGCTGCCACCAAAAAAAAAAAA
AAAAAATTCCTCTGACAACCTTCATAAAGTCCTGGGAGTTTGAACACCATTGCTCTAGGAAGTCATCTTA
TACAAAAATAAGAGTTGTGAGGTGGTTCATATACCTCCTGCGTTCTCCTATTTGGAGTTTTTCCCCATTT
ATGAAAGAGGTGAAAACGCTAAGATATTTAGCAATTATTACTTTAAACATTTTCTATTTATAGGCCGGGC
GCAGTGGCTCATGCCTGTAATCCCAGCGCTTGGGAGGCCAAGGCAGGCAGATCACGAGGTCAGGAGATCG
AGACCATCTTGGCTAACACGGTGAAACCCTGTCTCTACTAAAAAAATACAAAAATTTAGTTGGGCATGGT
GGGGGATACCTGTGGTCCCAGCTACTCGGGAGGCTGAGACAGGAGAATGGCTTGAACCTGGGAGGCCGAG
CTTGCAGTGAGCCAAGATCGCGCCACTGCACTCCAGCCTGGGTGACAGAGCAAGACTCTGTCTCGAAAAA
AAAAAAAAATTCTATTTACAGCAGTGAAAATAGTAGTGACTTAATGCACATTGCCAAGGCTTTAGCATAA
CATGAACACTTTCACTCAATGTCTCTCTGGCCTTTTGTTTTTCCTTGGGAAATTCTTATAATCCTGCTCC
GTCTTTAACTATTCATTTTGTATTGGCTATCCAAATATACCCAATAATGCTCTTTCTGAAAATATGCCAA
TTGTGGTAATTACAGCTAAGCTGGAATATTAAATTGTGATGTCTGTTTTCCAGAGAATGAAGTAGTATTC
CCCAGAGCATAGGCTTGGTGCCTGTGCAGGTTCTATTTTAAATATTCCAGGAAGGGTTGTTTTATATACT
GAGGATGATTTTACTGGTCTTGCCAGTCGTCTGAAATGCTGGTATTACTCTTGTGGAAGGTTTATTCAAA
CAAACAAGGACATTTCACACAATACCTAGTCATGTTTTTCAGACATTTTAATGTTTGGTTCATCATTTGC
ACACACTCTCAAAAATCTAGGTTTGTCTATGTGTTCATATCATTTTGCCTGTTGCCAGCTCAGTCAGCAG
GCACACTCTCCCAGGCTGTTGCTGTTTTGTTAGACTTCTTCAGGACCTTCATCTAAAATGGTCTTCCACA
CGTAGCTATACTGCATAAGTTCACATCATCTGTTTCTTGCATGTGGGTTGTGTCTCAACTCAAGTTTAAG
TTAGATTTGGAAGGGCGGAAACTATAGGAGTTGCAGCTTCAGTGGAGAAAAGAGCATTTCCTACTAGTTA
TGGCTTCCCAAGGAAGGTTAGATTCCTCAGAGTAGGAGTGATTCCCCAATGCTAGAACCTTTGGTCAAAT
ATAATTCTAATCCAGTCAAAATAAATACAGGTATTCTGTAAAACCCGATTTCATTTTGTAAATCCTACTT
TGTATAGTATAAGCAATTTTTGTATTTGTGTGGATTATATTTTATTTTCCTATTTCAAAGAGAAGAATTT
GTATTAGCAGACTCCCTTTGCATGCGGAGAGGGGATCATTTTCCCAGTAGGCATGGGGTTCCCTTCCATT
CCTTGTCCAGTCTTCTTTTCCCCACTAAGTTAAGTCAAACTAAGCAGCTGGTAAGATATTCCCTGGTTCT
TGCAAAGAAAGTGAGCAGATGGCAGAATGTATAGCTCTAAGCAGAATACCTGGTGTGGTATCCTCAAACA
CAAATTGACAGGAGGGTGTGGTGTGGCAAGCTCATTGTGGGGGTAAATTGGAATAAGCTTACAGGGGGAA
GAGTTGACAAAAGATAGGAAGAACCTTAAAAATATAGATGCCTTTTATGCAGTGATAAAATGTCTAGATA
TTTATACTGTGGTGATTATTAGGAATATGTGCAAAGATTGGCTATTAGGATGTTCATTACAGTGTTGTTT
AATAATTATAAAAGGACAGAAAGCAATGTGGACTCAAAAATAGGAAAAGAATTTAAATAAATCCTAGTGT
ACCCGTTATACATGAAATTATGGAAATATGACCCTGAGCATGGAAATATGTACATGAGAATGTCTAAAAG
CTAGTTCATTTTGAAAAACAAAATAATGTCACCTCATATTATTTATAGTATATAAAGATGATTTTAAGAG
TGGCAGTGTCTGGGATTATAGGTGATTGTATTTCTTCCCTTTTGCACATCTATGTTCTCTCATTTGTATT
GTGTGGGGAGAAGTGACTTTTTTTATAAAAAGAAAAAGGTATATGCATCCCAGCAGAGAAGCACTGGCTC
CACCCAGTACCTGCCTCCTCATGCCACCCTCTCAAGCCAAAAGCCGGGGGAAGCCCAGGCACCTTGACCA
TGACCGCCCGAGACTCACACTTCTTCTTTCTCATCAGGGAAGGAAAGCCCCCCTGTAAGCGATACTCCAG
ATGAGGGCGATGAGCCCATGCCGATCCCCGAGGACCTCTCCACCACCTCGGGAGGACAGCAAAGCTCCAA
GAGTGACAGAGTCGTGGGTAA
Protein Sequence
>gi|334085209|ref|NP_001207694.1| DNA-binding protein Ikaros isoform 2 [Homo sapiens]
MDADEGQDMSQVSGKESPPVSDTPDEGDEPMPIPEDLSTTSGGQQSSKSDRVVASNVKVETQSDEENGRA
CEMNGEECAEDLRMLDASGEKMNGSHRDQGSSALSGVGGIRLPNGKLKCDICGIICIGPNVLMVHKRSHT
GERPFQCNQCGASFTQKGNLLRHIKLHSGEKPFKCHLCNYACRRRDALTGHLRTHSVIKEETNHSEMAED
LCKIGSERSLVLDRLASNVAKRKSSMPQKFLGDKGLSDTPYDSSASYEKENEMMKSHVMDQAINNAINYL
GAESLRPLVQTPPGGSEVVPVISPMYQLHKPLAEGTPRSNHSAQDSAVENLLLLSKAKLVPSEREASPSN
SCQDSTDTESNNEEQRSGLIYLTNHIAPHARNGLSLKEEHRAYDLLRAASENSQDALRVVSTSGEQMKVY
KCEHCRVLFLDHVMYTIHMGCHGFRDPFECNMCGYHSQDRYEFSSHITRGEHRFHMS
Molecule Role Vaximmutor
Related Vaccines(s) FluMist
References