VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

PA

Gene Name PA
Sequence Strain (Species/Organism) Bacillus anthracis str. H9401
NCBI Gene ID 12796252
NCBI Protein GI 386733821
Locus Tag H9401_5741
Genbank Accession CP002093
Protein Accession YP_006204206
Taxonomy ID 768494
Plasmid No BAP2
Gene Starting Position 46551
Gene Ending Position 46985
Gene Strand (Orientation) -
Protein Name Phosphoesterase PA-phosphatase related protein
Protein pI 9.43
Protein Weight 14561.26
Protein Length 144
DNA Sequence
>NC_017727.1:46551-46985 Bacillus anthracis str. H9401 plasmid BAP2, complete sequence
ATTATAATTCCTTCGATTTACTTTTTAATGGTAAAACATATTGCTCTACTCTTTCATAAAGATTAAGTAT
TTGTGTAATAAATTTAATTTTTGGTACTATCCAATATGAAAATAAAGCTGAAATACTCCCTATTAAGGCG
CCTGTTGCAACATCAAAAGGATAATGAACCCCGACCCAAATACGAGAGATACCCACACAGAATGCAATTA
CAAGCAATAACAACCCAGCCTTTTTATGAACGAGCTTAACTGAAACACAAATTGAAAAAAATAGAATCGT
GTGATCACTAGGAAATGAATTATCCACTACATGATCAGCGAGTTTATTAACATCAGGTAATACTGCAAAT
GGTTGATAATTCAAATGCAATTTCCCTAGTAGCTTTCCAATTATCTCAGCAGTCATGAAAGCAAACACCG
CTTGTATAATCATCA

Protein Sequence
>YP_006204206.1 Phosphoesterase PA-phosphatase related protein (plasmid) [Bacillus anthracis str. H9401]
MMIIQAVFAFMTAEIIGKLLGKLHLNYQPFAVLPDVNKLADHVVDNSFPSDHTILFFSICVSVKLVHKKA
GLLLLVIAFCVGISRIWVGVHYPFDVATGALIGSISALFSYWIVPKIKFITQILNLYERVEQYVLPLKSK
SKEL

Molecule Role Protective antigen
Related Vaccines(s) B. anthracis DNA Vaccine expressing PA , Typhi strain Ty21a-PA (Bacillus anthracis)
References