VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

gag

Gene Name gag
Sequence Strain (Species/Organism) Reticuloendotheliosis virus strain APC-566
NCBI Protein GI 88605103
Other Database IDs CDD:307339
CDD:307969
CDD:197667
Taxonomy ID 11636
Gene Strand (Orientation) ?
Protein Name gag protein
Protein pI 8.36
Protein Weight 53536.51
Protein Length 562
Protein Note Matrix protein (MA), p15; pfam01140
Protein Sequence
>ABD46828.1 gag protein [Reticuloendotheliosis virus]
MGQAGSKGLLTPLECILKNFSDFKKRAGDYGEDVDSFTLRKLCELEWPTFGVGWPKEGTLDFRVVAAVRN
IVFGNPGHPDQVIYITVWIDITIERPKYLKDCGCKPTGPSKVLLASQKVNPRRPVLPSAPESPPRMRRAQ
FLDERPLSPAPAPPPPYPEVPAIAEEGEEGQQPDSTVMASPPHTRSGLEFGAQGPSGMYPLRETGERDMG
GRPMRTYVPFTTSDLYNWKNQNPSFSQAPDEVISLLESVFYTHQPTWDDCQQLLRTLFTTEERERVRTES
RREVRNDQGVQVTDEREIEAQFPATRPDWDPNTGRGNDNLERYRQILLRGLRAAARKPTNLSKITEVRQG
ADESPTAYLERLYQAYRTWSPIDPRAPENQAAIVIQFVSQSAPDIRKKIQKIDGFQGKSLSELVAIAQKV
FDQREDPAKATHELTQKMAKVLLAQESRAERGSKKTPPGKGRPPLGKNQCAYCKEEGHWKKNCPKLVSGA
TPVLVEELQ

Molecule Role Protective antigen
Related Vaccines(s) REV DNA vaccine VP22/gag and VP22/env
References