VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

env

Gene Name env
Sequence Strain (Species/Organism) Reticuloendotheliosis virus strain APC-566
NCBI Protein GI 88605105
Other Database IDs CDD:278837
CDD:197368
Taxonomy ID 11636
Gene Strand (Orientation) ?
Protein Name env protein
Protein pI 6.13
Protein Weight 60964.83
Protein Length 650
Protein Note ENV polyprotein (coat polyprotein); pfam00429
Protein Sequence
>ABD46830.1 env protein [Reticuloendotheliosis virus]
MDCLTNLRSAEGKVDQAGKTLILLVVWWGFGTTAEGYPLQQLWGLPCDCSGGYVFSIPTYYTNSLDCGSS
TAYLTYGSGTGSWGWGGGFRQQWECVFKPKIIPSVQGQPGPCPSECLTIATQMHSTCYEKAQECTLLGKT
YFTAILQKTKLGSYEDGPNKLLQASCTGTIGKPVCWDPVAPVYVSDGGGPTDMIREESVRERLEEIIRHS
YPSVQYHPLALPRPRGVDLDPQTYDILEATHQVLNATNPQLAENCWLCMTLGTPIPAAIPANGNVTLDGN
CSLSLPFRVQPTGSIDVNCYAGEADNRTGIPIGYVHFTNCTSIQEVSNETSHIRNLTRLCPPPGHVFVCG
NNMAYTALPNKWIGLCILASIVPDMSIISGEEPIPLPSIEYTAGRHKRAVQFIPLLVGLGITGATLAGGT
GLGVSVHTYHKLSNQLIEDVQALSGTINDLQDQIDSLAEVVLQNRRGLDLLTAEQGGICLALQEKCCFYA
NKSGIVRDKIRKLQEDLIARKRALYDNPLWNGLNGFLPYLLPLLGPLFGLILFLTLGPCIIKTLTRIIHD
KIQAVKILALVPQYKPLPTEMDTLGQ

Molecule Role Protective antigen
Related Vaccines(s) REV DNA vaccine VP22/gag and VP22/env
References