VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

VP22

Gene Name VP22
Sequence Strain (Species/Organism) Gallid herpesvirus 2 strain CVI988/Rispens
NCBI Protein GI 33090005
Other Database IDs CDD:309800
Taxonomy ID 10390
Gene Strand (Orientation) ?
Protein Name VP22
Protein pI 10.7
Protein Weight 26320.06
Protein Length 293
Protein Note Herpesvirus UL49 tegument protein; pfam04823
Protein Sequence
>AAP93873.1 VP22 [Gallid alphaherpesvirus 2]
MGDSERRKSERRRSLGYPSAYDDVSIPARRPSTRTQRNLNQDDLSKHGPFTDHPTQKYKSAKAVSEDVSS
TTRGGFTNKPRAKPGVRAVQSNKFAFSTAPSSASSTWRSNTVAFNQRMFCGAVATVAQYHAYQGALALWR
QDPPRTNEELDAFLSRAVIKITIQEGPNLMGEAETCARKLLEESGLSQGNENVKSKSERTRRGGEIEIKS
PDPGSHRTHNPRTPATSRRHHSSARGYRGSDSE

Molecule Role Protective antigen
Related Vaccines(s) REV DNA vaccine VP22/gag and VP22/env
References