VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

CSP from P. knowlesi

Gene Name CSP from P. knowlesi
Sequence Strain (Species/Organism) Plasmodium knowlesi strain H
NCBI Protein GI 221060580
Other Database IDs CDD:319368
EnsemblGenomes-Gn:PKH_134120
EnsemblGenomes-Tr:PKH_134120
GOA:B3LAV3
InterPro: IPR001841
InterPro: IPR013083
UniProtKB/TrEMBL: B3LAV3
Taxonomy ID 5851
Gene Strand (Orientation) ?
Protein Name circumsporozoite protein, putative
Protein pI 5.61
Protein Weight 73901.662
Protein Length 795
Protein Note RING finger, H2 subclass, found in the PA-TM-RING ubiquitin ligase family; cd16454
Protein Sequence
>XP_002260935.1 circumsporozoite protein, putative [Plasmodium knowlesi strain H]
MSISEHTGNEVSIAERKKKEEGSGGVINDKNVSPTDDGESMPHPMEKMKGAANDEKSVEVENCAPVGENE
LRSSVLCVGCSGEASHIEEGSAKFVGEENPRTEVDSDKKAQPEGILNEVKNVKNEIDVEKKHKTQISNND
TYVENAPNDNTCGEGCSNPHMNHDNKACDNGDDNDKIPNTGGTSNGGVIPNISGVLNVEDDCPLDEGNFS
ADDRPEENADSTSSFMLEEDINLSRRAYRNFHICSIFIHGTLLLMVTLLMGILCHDFIKLSPISQKEKTM
TYFCGLLLSMLALHLCLNLYMSLVLLRQSEVSKMLKSVEAKIHVIVLVYFSMCAYIYFFEDKYYPISSTF
SFAIILAIIYYFMPIFLYIILRLLFIVVILVLVFVKRKSPTPKKILKKLKIMKYVEYRKYCEEEACFGSA
YFTNWKELNGEGVSAPREATTTTAMEGGHIIATSGGDNKGEEVSSGDSTSNRNAEGKTISTATSCIRDIS
ANGSGHPKGGDPPSSSPNDRPTRSGNSSTRSNLERHLFYDRAGVAIGRGGGSDNRGGTRPNDRGRDDPAN
GNHQNGSDNANKHPPASYDNNCDAPNTSGEENGERNGGPNKDGKSAAVFEYFQKVLKKKNNSVQNDNVKV
VHENNMEEHSFHINIECSDYVCSICCVEYLNEDDICILPCNYLHYYHKECIFKWLKRNNDCPLCRKPIGK
I

Molecule Role Protective antigen
Related Vaccines(s) P. knowlesi DNA vaccine encoding PkCSP, PkSSP2, PkAMA1, and PkMSP1p42
References