VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

SSP2 from P. knowlesi

Gene Name SSP2 from P. knowlesi
Sequence Strain (Species/Organism) Plasmodium knowlesi strain H
NCBI Protein GI 221058683
Other Database IDs CDD:240420
EnsemblGenomes-Gn:PKH_121770
EnsemblGenomes-Tr:PKH_121770
InterPro: IPR000884
InterPro: IPR002035
UniProtKB/TrEMBL: B3L8N1
Taxonomy ID 5851
Gene Strand (Orientation) ?
Protein Name sporozoite surface protein 2, putative
Protein pI 4.27
Protein Weight 60249.802
Protein Length 675
Protein Note sporozoite surface protein 2 (SSP2); Provisional
Protein Sequence
>XP_002259987.1 sporozoite surface protein 2, putative [Plasmodium knowlesi strain H]
MKLLQNKSYLLVVFLLYVSIFARGDQKIVDEVKYNEEVCNEKVDLYLLVDGSGSIGYANWITRVIPMLTG
LIENLNLSKDSINLYMSLFASHTTELIRLGSGPSMDKKQALNVVRDLRKGYEPYGNTSMSSALSEVEMHL
KDRVNRPNAIQLVILMTDGIPNNKYRALELSRALKERNVKLAVIGIGQGINHQYNKLMAGCRPRERSCKF
YSSADWSEAISLIKPFIAKVCTEVERIAKCGPWDDWTPCSVTCGKGTHSRSRPLLHAGCTTHMVKECEMD
ECPVEPEPVPVPAPVPPTPEDENPRTTDEEDDHPNFHQGLDVPDVENDVPPENDGGDGNPFEENFFPPGD
DTVPDESNVIPVPPTVPGGSNSEFSSDVENAAQYPENPENPENPENSENPENPENQNNPEDFPMEPDMSA
DNKINEPTNPSDSGQGIPENVIPTPINNEKDIINKNKAVYPNGSNQSHDRYPKPHRNAGGYDNNPNANSD
IPEGPFSSEEEQPEDKGKKSSNNGYKIAGGVIAGLALVGCVGFAYNFVSSGGAAGMAGEPAPFDEAMAED
EKDAGEADQFKLPEDNDWN

Molecule Role Protective antigen
Related Vaccines(s) P. knowlesi DNA vaccine encoding PkCSP, PkSSP2, PkAMA1, and PkMSP1p42
References