VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

AMA1 from P. knowlesi

Gene Name AMA1 from P. knowlesi
Sequence Strain (Species/Organism) Plasmodium knowlesi strain H
NCBI Protein GI 221056402
Other Database IDs CDD:240241
EnsemblGenomes-Gn:PKH_093110
EnsemblGenomes-Tr:PKH_093110
GOA:B3L5E1
InterPro: IPR003298
InterPro: IPR024056
UniProtKB/TrEMBL: B3L5E1
Taxonomy ID 5851
Gene Strand (Orientation) ?
Protein Name apical merozoite antigen 1
Protein pI 6.98
Protein Weight 62359.812
Protein Length 647
Protein Note apical membrane antigen 1; Provisional
Protein Sequence
>XP_002259339.1 apical merozoite antigen 1 [Plasmodium knowlesi strain H]
MNKIYYILFLSAQCLVHMGKCERNQKTTRLTRSANNASLEKGPIIERSIRMSNPWKAFMEKYDLERAHNS
GIRIDLGEDAEVGNSKYRIPAGKCPVFGKGIVIENSNVSFLTPVATGAQRLKEGGFAFPNADDHISPITI
ANLKERYKENADLMKLNDIALCKTHAASFVIAEDQNTSYRHPAVYDEKNKTCYMLYLSAQENMGPRYCSP
DSQNKDAMFCFKPDKNEKFDNLVYLSKNVSNDWENKCPRKNLGNAKFGLWVDGNCEEIPYVNEVEARSLR
ECNRIVFEASASDQPRQYEEELTDYEKIQEGFRQNNRDMIKSAFLPVGAFNSDNFKSKGRGYNWANFDSV
NNKCYIFNTKPTCLINDKNFFATTALSHPQEVDNEFPCSIYKDEIEREIKKQSRNMNLYSVDKERIVLPR
IFISTDKESIKCPCEPEHISNSTCNFYVCNCVEKRAEIKENNEVIIKEEFKEDYENPDGKHKKKMLLIII
GVTGAVCVVAVASLFYFRKKAQDDKYDKMDQAEAYGKTANTRKDEMLDPEASFWGEDKRASHTTPVLMEK
PYY

Molecule Role Protective antigen
Related Vaccines(s) P. knowlesi DNA vaccine encoding PkCSP, PkSSP2, PkAMA1, and PkMSP1p42
References