VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

env

Gene Name env
Sequence Strain (Species/Organism) Human immunodeficiency virus 1 isolate 715 from Baltimore clone 6
NCBI Protein GI 475647
Other Database IDs CDD:278917
CDD:295533
CDD:197369
Taxonomy ID 11676
Gene Strand (Orientation) ?
Protein Name envelope glycoprotein
Protein pI 8.4
Protein Weight 91460.08
Protein Length 942
Protein Note Envelope glycoprotein GP120; pfam00516
Protein Sequence
>AAB04079.1 envelope glycoprotein, partial [Human immunodeficiency virus 1]
VTGIRKNCQHWWKWGIMLLGILMICNATEKLWVTVYYGVPVWKEANTTLFCASDAKAYDTEVHNVWATHA
CVPTDPDPQEVELENVTENFNMWKNNMVEQMHEDIISLWDQSLKPCVKLTPLCVTLNCTNLRNDTNTTRN
ATNTTSSETMMEEGEIKNCSFNITTSIRDKVQKEFALFYKLDVVPIENDTTSYRLISCNTSVLTQACPKV
SFEPIPIHFCAPAGFAILKCKDKKFNGTGPCTNVSTVQCTHGIKPVVSTQLLLNGSLAEEEVVIRSANLS
DNAKTIIVQLNESVQMNCTRPNNNTRKSIHIGPGRAFYTTGEIIGDIRQAHCNLSRTKWNETLKRIVIKL
REQYENKTIVFNQSSGGDPEIVMLSFNCGGEFFYCNSTKLFNSTWNGTESNNTGDDPIVLPCRIKQVINM
WQEVGKAMYAPPIRGQIRCSSNITGLLLTRDGGNSNETNTTEIFRPGGGNMKDNWRSELYKYKVVRIEPL
GIAPTRAKRRVVQREKRAAGLGVMFLGFLGAAGSTMGAASIALTVQARQLLSGIVQQQNNLLRAIEAQQH
MLQLTVWGIKQLQARVLAVERYLRDQQLLGIWGCSGKLICTTTVPWNASWSNKSHDQIWQNMTWMQWEKE
IDNYTSLIYNLIEVSQNQQEKNEQELLELDKWASLWNWFDITNWLWYIKIFIMIVGGLIGLRIVFIVLSI
VNRVRQGYSPLSFQTHLPARRGPDRPEGIEEEGGERDRDRSGQLVTGFLAIIWVDLRSLCLFSYHRLRDL
LLIVARIVELLGRRGWEILKYWWNLLQYWSQELKSGAVSLLNATAIAVAEGTDRVIEVLQRAGRAILHIP
RRIRQGFERALL

Molecule Role Protective antigen
Related Vaccines(s) SHIV DNA vaccine encoding env and gag , SHIV(Ba-L) DNA vaccine encoding env and gag
References