VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

htpB

Gene Name htpB
Sequence Strain (Species/Organism) Coxiella burnetii
VO ID VO_0010934
NCBI Protein GI 197253489
Locus Tag AY251297
Other Database IDs CDD:234573
CDD:237231
CDD:239460
Taxonomy ID 777
Gene Strand (Orientation) ?
Protein Name heat shock protein B
Protein pI 4.88
Protein Weight 51650.62
Protein Length 612
Protein Note chaperonin GroEL; Reviewed; PRK00013
DNA Sequence
>gi|30142089|gb|AY251297.1| Coxiella burnetii strain Xinqiao heat shock protein B (htpB) gene, complete cds
ATGGCTGCAAAAGTTTTAAAATTTTCCCACGAGGTATTACACGCAATGAGTCGTGGCGTGGAAGTTTTGG
CCAACGCGGTAAAAGTGACGTTGGGACCAAAAGGTCGCAATGTCGTTTTAGATAAATCATTTGGCGCACC
AACCATTACTAAAGACGGCGTTAGCGTAGCTAAAGAAATCGAGTTGGAAGACAAATTTGAAAATATGGGC
GCTCAAATGGTTAAAGAAGTGGCTTCGCGTACATCAGACGATGCGGGTGATGGTACCACAACAGCGACCG
TACTGGCTCAAGCGATTTTGGTTGAAGGCATCAAAGCCGTTATTGCTGGAATGAACCCCATGGATTTGAA
ACGGGGTATTGATAAAGCCGTAACGGCAGCGGTAGCTGAATTGAAGAAAATTTCCAAGCCTTGCAAAGAC
CAGAAAGCGATTGCGCAAGTAGGCACCATTTCTGCGAATTCGGATAAGTCGATTGGAGATATTATTGCGG
AAGCGATGGAGAAAGTGGGCAAAGAAGGCGTCATAACAGTAGAAGATGGCTCTGGTCTTGAAAACGCGCT
TGAAGTAGTTGAAGGTATGCAGTTCGATCGTGGTTACTTGTCGCCATACTTTATCAACAATCAACAAAAC
ATGAGTGCGGAGCTTGAAAATCCGTTTATCTTATTGGTTGACAAGAAGATTTCTAATATTCGTGAACTCA
TTCCGTTGTTAGAAAACATAGCAAAGTCTGGTCGGCCCTTATTGGTGATTGCCGAAGATATCGAAGGCGA
AGCTTTAGCGACGTTAGTGGTTAATAATATTCGCGGTGTTGTTAAAGTCGCGGCTGTAAAAGCACCTGGC
TTTGGCGATCGTCGTAAAGCGATGTTGCAAGATATTGCTGTTTTGACGGGCGGTAAGGTTATTTCTGAAG
AAGTCGGATTGTCCCTTGAGGCCGCTTCTTTGGATGATTTAGGTTCTGCTAAACGCGTTGTTGTCACTAA
AGATGACACCACCATCATTGATGGTTCTGGTGACGCCGGTGACATTAAAAACCGCGTGGAGCAAATCCGA
AAAGAAATAGAAAATAGCTCGTCGGACTATGATAAAGAGAAATTACAAGAACGTCTGGCAAAATTAGCCG
GTGGTGTGGCGGTCATTAAAGTGGGCGCTGCGACTGAAGTTGAAATGAAAGAGAAAAAAGCCCGCGTGGA
AGATGCCTTACATGCGACGCGCGCAGCCGTCGAAGAAGGTGTCGTACCGGGTGGTGGCGTTGCTTTAATC
CGCGTGCTTAAATCGCTTGATTCAGTGGAAGTTGAGAATGAAGACCAACGCGTGGGCGTGGAAATTGCTC
GCCGTGCGATGGCTTACCCGCTTTCTCAAATCGTGAAAAACACGGGTGTTCAAGCAGCCGTTGTCGCTGA
CAAAGTCTTGAACCATAAAGACGTTAATTATGGTTATAACGCAGCGACGGGTGAATACGGTGACATGATT
GAGATGGGTATTCTCGACCCAACCAAAGTGACCCGCACCGCGTTGCAAAACGCAGCTTCTATCGCTGGTC
TTATGATTACCACCGAATGTATGGTAACAGAAGCTCCCAAGAAGAAAGAGGAGTCGATGCCCGGCGGCGG
TGACATGGGCGGCATGGGAGGAATGGGCGGCATGGGCGGCATGATGTAA
Protein Sequence
>ACH54112.1 heat shock protein B, partial [Coxiella burnetii]
AAKVLKFSHEVLHAMSRGVEVLADAVKVTLGPKGRNVVLDKSFGAPTITKDGVSVAKEIELEDKFENMGA
QMVKEVASRTSDDAGDGTTTATVLAQAILVEGIKAVIAGMNPMDLKRGIDKAVTAAVAELKKISKPCKDQ
KAIAQVGTISANSDKSIGDIIAEAMEKVGKEGVITVEDGSGLENALEVVEGMQFDRGYLSPYFINNQQNM
SAELENPFILLVDKKISNIRELIPLLENVAKSGRPLLVIAEDIEGEALATLVVNNIRGVVKVAAVKAPGF
GDRRKAMLQDIAVLTGGKVISEEVGLSLEAASLDDLGSAKRVVVTKDDTTIIDGSGDAGDIKNRVEQIRK
EIENSSSDYDKEKLQERLAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGVVPGGGVALIR
VLKSLDSVEVENEDQRVGVEIARRAMAYPLSQIVKNTGVQAAVVADKVLNHKDVNYGYNAATGEYGDMIE
MGILDPTKVTRTALQNAASIAGLMITTECMVTEAPKKKEESMPGGGDMGGM

Molecule Role Protective antigen
Molecule Role Annotation The purified recombinant proteins, P1, HspB, and P1-HspB, and whole-cell antigen (WCA) of C. burnetii were used to immunize BALB/c mice. Protective immunity against Q fever was induced with a recombinant P1 antigen fused with HspB after Coxiella burnetii challenge (Li et al., 2005).

This result showed that these proteins had the ability to evoke a humoral immune response and yield specific antibodies whose reactivity increased gradually with the progression of the infection. In addition, 15 proteins on the array had higher FI values than the Coxiella outer membrane protein 1 (Com1), which is the first surface protein antigen of C. burnetii recognized by Q fever sera. This suggests that these proteins might be major seroreactive antigens of C. burnetii. (Wang et al., 2013)
Related Vaccines(s) P1-HspB (fusion of protein 1 and heat-shock protein B)
References