VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

AroD

Gene Name AroD
Sequence Strain (Species/Organism) Salmonella enterica subsp. enterica serovar Typhi Ty2
NCBI Gene ID 1070649
NCBI Protein GI 29141695
Locus Tag t1231
Genbank Accession NC_004631.1
Protein Accession NP_805037.1
3D structure: PDB ID 1QFE
Taxonomy ID 28901
Gene Starting Position 1298692
Gene Ending Position 1299450
Gene Strand (Orientation) -
Protein Name 3-dehydroquinate dehydratase
Protein pI 6.23
Protein Weight 27648.7
Protein Length 252
Protein Note catalyzes the dehydration of 3-dehydroquinate to form 3-dehydroshikimate in aromatic amino acid biosynthesis
DNA Sequence
>GeneID|1070649 [Salmonella enterica subsp. enterica serovar Typhi Ty2 ] 1298692..1299450
aggcgttgtgcagaatcattaatacactgcgtagatcatttacggcgatttgccccggcgctgaagcctg
cttcaccgcgccaaacgtggcggcagagccaaacacttcccctgccagacgtgaaatgacaccctctttc
gccattgacatagtaattaccggacggtcggcgtaatgttgctgcatctccagcgtggcagtgagtaacg
ttaatacatcatgcttgctttgcggcataacggcaatcttgggaatatccgcgccgagtgcttgcatttt
acgtagccgcagaaccatttcctctgcggacggcgtctggtgaaaatcgtggttagacatcacgacataa
acattatgcgcatgggcataatcgacagtggctttaacgtcagcatcaccggtaaatagctcaagatcga
tcatatcgaccaggccgctgtcgattgcggcacgattaagcgtgagataatgctgagtggttattgtctg
ctcgccgccttctttggcgctgcggaaagtaaacagtaacggaatgtcaggcatcgcatcgcggataaca
cgcgcagcggtaagaacggattgagtcgatgcgatatccataaagtgatccacgcgccactccagaatat
cgaatgtagcttcgcggtaggccagcgcctccgctttcacgctattgatgtctcttcccatcaacgacac
gataattttgggcatcccttcgccaatgataagattttttacggtgacggttttcatgc
Protein Sequence
>gi|29141695|ref|NP_805037.1| 3-dehydroquinate dehydratase [Salmonella enterica subsp. enterica serovar Typhi Ty2 ]
MKTVTVKNLIIGEGMPKIIVSLMGRDINSVKAEALAYREATFDILEWRVDHFMDIASTQSVLTAARVIRD
AMPDIPLLFTFRSAKEGGEQTITTQHYLTLNRAAIDSGLVDMIDLELFTGDADVKATVDYAHAHNVYVVM
SNHDFHQTPSAEEMVLRLRKMQALGADIPKIAVMPQSKHDVLTLLTATLEMQQHYADRPVITMSMAKEGV
ISRLAGEVFGSAATFGAVKQASAPGQIAVNDLRSVLMILHNA
Molecule Role Virmugen
Molecule Role Annotation Inactivation of AroD results in attenuation in humans, and the deletions of both AroC and AroD provide a high level of safety against restoration of pathogenicity by recombination. An aroC/aroD-deleted derivative of S. Typhi strain Ty2 (the parent strain of Ty21a) is designated the strain "CVD 908" (Tacket and Levine, 2007).
Related Vaccines(s) Aro-deleted S. Typhi
References