VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

AroC

Gene Name AroC
Sequence Strain (Species/Organism) Salmonella enterica subsp. enterica serovar Typhi Ty2
NCBI Gene ID 1069415
NCBI Protein GI 29140996
Locus Tag t0480
Genbank Accession NC_004631.1
Protein Accession NP_804338.1
Taxonomy ID 28901
Gene Starting Position 554066
Gene Ending Position 555151
Gene Strand (Orientation) +
Protein Name chorismate synthase
Protein pI 6.68
Protein Weight 39122.2
Protein Length 361
Protein Note catalyzes the formation of chorismate from 5-O-(1-carboxyvinyl)-3-phosphoshikimate in aromatic amino acid biosynthesis
DNA Sequence
>GeneID|1069415 [Salmonella enterica subsp. enterica serovar Typhi Ty2 ] 554066..555151
tggcaggaaacacaattggacaactctttcgcgtaaccactttcggcgaatcacacgggctggcgcttgg
gggtatcgtcgatggcgtgccgcccggcatcccgttgacggaggccgatctgcagcacgatctcgacaga
cgccgccctggcacctcgcgctatactactcagcgccgcgaaccggaccaggtaaaaattctctccggcg
tgtttgatggcgtgacgaccggcaccagtattggcctgctgattgaaaacaccgatcagcgctcgcagga
ctacagcgcgattaaagatgtttttcgcccgggacacgcggattacacctatgagcagaaatacggcctg
cgcgattaccgcggcggtggacgttcttccgcgcgtgaaaccgcgatgcgcgtagcggcaggggcgatcg
ccaagaaatacttggcggaaaagttcggcatcgaaatccgcggctgcctgacccagatgggcgacattcc
gctggagattaaagactggcgtcaggttgagcttaatccgttcttttgccccgatgcggacaaacttgac
gcgctggacgaactgatgcgcgcgctgaaaaaagagggtgactccatcggcgcgaaagtgacggtgatgg
cgagcggcgtgccggcagggcttggcgaaccggtatttgaccgactggatgcggacatcgcccatgcgct
gatgagcatcaatgcggtgaaaggcgtggagatcggcgaaggatttaacgtggtggcgctgcgcggcagc
cagaatcgcgatgaaatcacggcgcagggttttcagagcaaccacgctggcggcatcctcggtggcatca
gtagtgggcaacacattgtggcgcatatggcgctgaaacctacctccagcattaccgtgccgggacgtac
gatcaaccggatgggtgaagaggtcgagatgatcaccaaagggcgccacgatccgtgtgtggggattcgc
gcagtgccgatcgcagaagccatgctggcgatcgtactgatggatcacctgctgcgccatcgggcacaga
atgcggatgtaaagacagagattccacgctggtaag
Protein Sequence
>gi|29140996|ref|NP_804338.1| chorismate synthase [Salmonella enterica subsp. enterica serovar Typhi Ty2 ]
MAGNTIGQLFRVTTFGESHGLALGGIVDGVPPGIPLTEADLQHDLDRRRPGTSRYTTQRREPDQVKILSG
VFDGVTTGTSIGLLIENTDQRSQDYSAIKDVFRPGHADYTYEQKYGLRDYRGGGRSSARETAMRVAAGAI
AKKYLAEKFGIEIRGCLTQMGDIPLEIKDWRQVELNPFFCPDADKLDALDELMRALKKEGDSIGAKVTVM
ASGVPAGLGEPVFDRLDADIAHALMSINAVKGVEIGEGFNVVALRGSQNRDEITAQGFQSNHAGGILGGI
SSGQHIVAHMALKPTSSITVPGRTINRMGEEVEMITKGRHDPCVGIRAVPIAEAMLAIVLMDHLLRHRAQ
NADVKTEIPRW
Molecule Role Virmugen
Molecule Role Annotation Inactivation of AroC results in attenuation in humans, and the deletions of both AroC and AroD provide a high level of safety against restoration of pathogenicity by recombination. An aroC/aroD-deleted derivative of S. Typhi strain Ty2 (the parent strain of Ty21a) is designated the strain "CVD 908" (Tacket and Levine, 2007).
Related Vaccines(s) Aro-deleted S. Typhi , CVD 908-htrA
References