VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

IcsA/VirG

Gene Name IcsA/VirG
Sequence Strain (Species/Organism) Shigella flexneri 2a str. 301
NCBI Gene ID 1238021
NCBI Protein GI 31983529
Locus Tag CP0182
Genbank Accession NC_004851.1
Protein Accession NP_858315.1
3D structure: PDB ID 3ML3
Plasmid No pCP301
Gene Starting Position 149644
Gene Ending Position 152952
Gene Strand (Orientation) +
Protein Name IcsA (VirG), outermembrane protein exposed to the bacterial surface by a C-terminal autotransporter domain and involved in the movement of intracellular bacteria by binding to N-WASP
Protein pI 5.31
Protein Weight 116243.6
Protein Length 1102
DNA Sequence
>GeneID|1238021 [Shigella flexneri 2a str. 301 ] 149644..152952
tcaccagacgctgcagttcagcattacgttcaacttcagctcgcaaggccaacaggtcataagccgcacg
gaacttaggatgctccagcagtttccatgcgcgtttaccctgacgacgggacatacgcaactgcaactgc
cagatatcgcgggttaacgtcgtcagacgtttcgggattgccagtgaacggcaggcttcgtccagcacgt
cgttcatcgccagcgcgaaagcgtcgtgataggtcaggccgctttcctgggcgatcttctgtgccgtctc
cagcagtgggtaccagaacatggcggcaaacaagaacgccgggttcacgcgcatatcgttatggatacgc
gtatcggtattcttcagcacctgttcaatgatccgctccatcgggctgtcgccattttccgtgaagtagc
gggtaatggtcgggaacagcggctggaacagatgatattcacacaacagcttataggtttcgtaaccgta
gcccgcttgtagcagtttaagcgattcttcaaacaggcgtgccggtgggatatcgttcagcagggtagcg
aggcgagggatcggttctgcggtttccgggctgatgcgcatacccaatttggcggcaaaacgtaccgcgc
gcagcatacgtaccggatcttcacggtagcgcgtttccgggttaccaatcagacggataacgccgtcctt
cagatccttcataccaccaacgtaatcacggacggtaaaatccgctacgctgtaatacaggctgttgata
gtgaaatcgcggcgctgggcgtcttcttcgatggagccgaaaatgttgtcgcgcagcaacatgccgtttt
gcccgcgttgggaggtcgtgcggtcgctgacgttaccttcgtggtgtccacggaaggtcgcaacttcgat
aatctccgggccaaacattacatgagccagacggaaacggcgacccaccaggcggcagttacggaacagt
ttgcgcacctgctcaggcgtggcgttagtggttacgtcaaaatctttcggctttttgccaagtaacaggt
cgcgcacgccgccgccaaccagccaggcttcgtatcccgctttgttgagcctgtacattaccttcagggc
attttcactgatatctttgcgggaaatagcatgctgctcacgcgggatcaccgtcacctgtggacgggcg
actgcctgttcagcctcgctttcctcgcggcttagcaccttgcggcaaaaattagcgactcgggtaaaaa
tagtacacctcggtagtgtcaaacatcattcaggacaaaaaaatagcggctaatcatagctcagcatgac
gcatttgagaatgttgaatttacaattgccgactcgggcacggcggtcagcatccagtttttgacggctg
actgaaggatttgctcgacgctgaaatcctgccagtgtgcttctgcctgctgccccagaaattgaagtgc
cgcgattagtaccgggcgtggatcgcctttcggcaacgcaggcgcatgattctgcttggaaagtttagcg
ccttgtggattaagcgccagcggcagatgaatgtaatctggcactttccagccaaaaagctggtacagcg
ggatttgccttactgttggttcaatcagatcagccccacgcactatttctgtaacgccctggaaatgatc
atcaaccacaacagccaggttgtaggcgaacaacccatcacggcgatgaatgataaaatcttcccgtgcc
agtttttcgtcggcgtgaataatgcctcgcagcaggtcagtaaattgcgtgaccggatgctgctggcgga
tacgcactgcggcgttgtctggtccatgatgcaacacccggcaatgaccgtcgtaaataccgccaatgct
ttgaatacgcgcacgcgtacaggtgcagtaataacttagtccttgttcatgtaaccaggcgagtgcttca
cgataggcgtcgtgacgttgcgattgccagagaacatcgccgtcccagtgcagaccgtaatgttccagct
ggcgcaggatagtttctgcggcaccgggaacttcacgaggcgggtcgatatcttctatgcgtaccagcca
gcgaccttgccgggcgcgagcctgcaaatagctgccgagcgcggcgatcagagagccaaaatgaagctcg
ccggaaggagagggggcgaagcggccaatatactgtgtgtctgtcatctctttgaacaaaaaataaggcg
ggagcatttcccgcctgtggtaaacgtgatggaacggctgtaattagccagccatctgtttttcgcgaat
ttcagccagcgttttgcagtcgatgcacagatcggctgtcgggcgcgcttccagacggcgaataccaatt
tcaacaccgcaggattcgcagtagccgaaatcttcgtcttccacttttttcagcgtcttctcgatctttt
tgatcagcttacgctcgcgatcgcggttacgcagttcgaggctgaactcttcttcctgggctgcacggtc
taccgggtccgggaagttggctgcttcatcctgcatatgtgtaacggtgcgatcgacttcatccctgagt
tgattacgccatgcttccagaatacgacggaagtgcgccagctgggcttcattcatatactcttcgcccg
gcttctcctgatatggttccaccccagcgatggcgagaatactcagggacgatgttttacggttttgccc
ttcttgcatgttgcttctccttaacacgcactatcgatccccatgttcgggggaaaaatgaggccgctat
aaatagcagatgcttttccggatagcaattatctaaacgtaacacttgacaactgtgtgaggaaaagcgt
atttgcgcacgcgaccagaatgtaaattaaccagttacttactttactacaatgtaaccggcagtgattt
tttaagagccatgccttcagcagaaatttccgctttgtaagccagaatttctacccccctctgttgagct
tctgacaatagttgcgcgtatttctcatcgatgtggcgcgcgggtgaaaaccgtgtaatggctgaatgca
gcacggcgaaaaaaataaccgcacgctggccttcagccgctacgctcatcaactcccgaaggtgtttctg
acctcgttcagtgaccgcatcgggaaaatatccctgttcgttctccgctaacgtaaccgatttcacttca
atatagcagtctggacgcgaatccgcctgcaacataaagtcaatacggctgcgttcggagccgtatttta
cttcgcttttcagcgagct
Protein Sequence
>gi|31983529|ref|NP_858315.1| IcsA (VirG), outermembrane protein exposed to the bacterial surface by a C-terminal autotransporter domain and involved in the movement of intracellular bacteria by binding to N-WASP [Shigella flexneri 2a str. 301 ]
MNQIHKFFCNMTQCSQGGAGELPTVKEKTCKLSFSPFVVGASLLLGGPIAFATPLSGTQELHFSEDNYEK
LLTPVDGLSPLGAGEDGMDAWYITSSNPSHASRTKLRINSDIMISAGHGGAGDNNDGNSCGGNGGDSITG
SDLSIINQGMILGGSGGSGADHNGDGGEAVTGDNLFIINGEIISGGHGGDSYSDSDGGNGGDAVTGVNLP
IINKGTISGGNGGNNYGEGDGGNGGDAITGSSLSVINKGTFAGGNGGAAYGYGYDGYGGNAITGDNLSVI
NNGAILGGNGGHWGDAINGSNMTIANSGYIISGKEDDGTQNVAGNAIHITGGNNSLILHEGSVITGDVQV
NNSSILKIINNDYTGTTPTIEGDLCAGDCTTVSLSGNKFTVSGDVSFGENSSLNLAGISSLEASGNMSFG
NNVKVEAIINNWAQKDYKLLSADKGITGFSVSNISIINPLLTTGAIDYTKSYISDQNKLIYGLSWNDTDG
DSHGEFNLKENAELTVSTILADNLSHHNINSWDGKSLTKSGEGTLILAEKNTYSGFTNINAGILKMGTVE
AMTRTAGVIVNKGATLNFSGMNQTVNTLLNSGTVLINNINAPFLPDPVIVTGNMTLEKNGHVILNNSSSN
VGQTYVQKGNWHGKGGILSLGAVLGNDNSKTDRLEIAGHASGITYVAVTNEGGSGDKTLEGVQIISTDSS
DKNAFIQKGRIVAGSYDYRLKQGTVSGLNTNKWYLTSQMDNQESKQMSNQESTQMSSRRASSQLVSSLNL
GEGSIHTWRPEAGSYIANLIAMNTMFSPSLYDRHGSTIVDPTTGQLSETTMWIRTVGGHNEHNLADRQLK
TTANRMVYQIGGDILKTNFTDHDGLHVGIMGAYGYQDSKTHNKYTSYSSRGTVSGYTAGLYSSWFQDEKE
RTGLYMDAWLQYSWFNNTVKGDGLTGEKYSSKGITGALEAGYIYPTIRWTAHNNIDNALYLNPQVQITRH
GVKANDYIEHNGTMVTSSGGNNIQAKLGLRTSLISQSCIDKETLRKFEPFLEVNWKWSSKQYGVIMNGMS
NHQIGNRNVIELKTGVGGRLADNLSIWGNVSQQLGNNSYRDTQGILGVKYTF
Molecule Role Virmugen
Molecule Role Annotation An aroA and virG mutant (CVD 1203) is attenuated in guinea pigs, as shown by the Sereny test. Guinea pigs inoculated with CVD 1203 were also protected from challenge with wild type S. flexneri (Noriega et al., 1994).
Related Vaccines(s) S. flexneri 2a strain CVD 1207 , SC602
References