VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

virG

Gene Name virG
Sequence Strain (Species/Organism) Shigella sonnei Ss046
NCBI Gene ID 3670887
NCBI Protein GI 74314980
Locus Tag SSON_P143
Genbank Accession CP000039
Protein Accession YP_313398
Other Database IDs icsA; S0192
Taxonomy ID 300269
Plasmid No pSS_046
Gene Starting Position 126065
Gene Ending Position 129373
Gene Strand (Orientation) +
Protein Name IcsA/VirG
Protein pI 5.38
Protein Weight 111073.91
Protein Length 1102
DNA Sequence
>gi|74314838:126065-129373 Shigella sonnei Ss046 plasmid pSS_046, complete sequence
CATGAATCAAATTCACAAATTTTTTTGTAATATGACCCAATGTTCACAGGGGGGGGCCGGAGAATTACCT
ACGGTAAAGGAAAAAACATGCAAATTGTCTTTTTCTCCTTTTGTTGTTGGTGCATCCCTGTTGCTCGGGG
GGCCAATAGCTTTTGCTATTCCTCTTTCGGGTACTCAAGAACTTCATTTTTCAGAGGACAATTATGAAAA
ATTATTAACACCTGTTGATGGACTTTCTCCCTTGGGAGCTGGTGAAGATGGAATGGATGCGTGGTATATA
ACTTCTTCCAACCCCTCTCATGCATCTAGAACTAAGCTACGGATTAACTCTGATATTATGATTAGCGCAG
GTCATGGTGGTGCTGGTGATAATAATGATGGTAATAGTTGTGGCGGTAATGGTGGTGACTCTATTACCGG
ATCTGACTTGTCTATAATCAATCAAGGCATGATTCTTGGTGGTAACGGCGGTAGCGGTGCTGACCATAAC
GGTGATGGTGGTGAGGCTGTTACAGGAGACAATCTGTTTATAATAAATGGAGAAATTATTTCAGGTGGAC
ATGGTGGCGATAGTTATAGTGATAGTGATGGGGGGAATGGAGGTGATGCCGTCACAGGAGTCAATCTACC
CATAATCAACAAAGGGACTATTTCCGGTGGTAATGGAGGTAACAATTATGGTGAGGGTGATGGCGGTAAT
GGAGGTGATGCCATCACAGGAAGCAGCCTCTCTGTAATCAATAAGGGCACGTTCGCTGGAGGCAACGGAG
GTGCTGCTTACGGTTATGGTTATGATGGCTACGGTGGTAATGCTATCACAGGAGATAACCTGTCTATAAT
CAACAATGGAGCTATTTTAGGCGGTAATGGTGGACATTGGGGGGATGCTATAAATGGTAGCAATATGACC
ATTGCTAATAGCGGATATATAATTTCAGGTAAAGAAGATGATGGAACACAAAATGTAGTAGGTAATGCTA
TCCACATCACTGGTGGAAACAATTCATTAATACTCCATGAAGGTTCTGTCATTACTGGTGATGTACAGGT
TAACAATTCATCCATTCTGAAAATTATCAACAATGATTACACTGGGACCACACCAACTATTGAAGGTGAT
TTATGTGCTGGTGATTGTACAACTGTTTCACTATCAGGTAACAAATTCACTGTTTCAGGTGACGTTTCTT
TTGGTGAGAACAGTTCTTTAAATTTAGCTGGAATCAGTAGTCTGGAAGCTTCTGGAAATATGTCATTTGG
CAACAATGTAAAAGTGGAAGCTATTATAAATAACTGGGCGCAGAAGGACTATAAACTGCTAAGTGCAGAT
AAAGGGATAACAGGTTTCAGTGTTTCTAATATATCTATCATCAATCCGTTACTCACTACTGGTGCTATTG
ACTATACAAAAAGCTATATCAGTGACCAGAATAAATTGATCTACGGTTTGAGCTGGAATGATACAGATGG
CGACAGTCATGGAGAGTTCAATCTGAAAGAAAACGCTGAACTTACTGTTAGTACTATTCTGGCAGATAAT
CTCAGCCATCATAATATAAATAGCTGGGACGGAAAATCCCTAACAAAATCAGGGGAGGGAACTCTCATTT
TGGCGGAAAAAAATACCTACTCTGGTTTCACCAACATCAATGCAGGCATTCTAAAAATGGGGACAGTTGA
AGCTATGACACGTACCGCTGGTGTTATTGTTAATAAAGGTGCTACCTTGAATTTTTCAGGCATGAACCAA
ACTGTTAACACTTTATTAAATAGTGGGACTGTGCTAATCAATAATATTAATGCCCCTTTTTTGCCTGACC
CCGTCATTGTCACAGGTAACATGACTCTGGAGAAAAACGGTCATGTTATTCTCAATAATAGTTCGTCAAA
TGTCGGTCAGACCTATGTTCAGAAAGGTAATTGGCATGGAAAGGGCGGAATATTATCTTTGGGCGCGGTT
CTCGGCAATGACAACAGTAAAACTGACCGGCTGGAAATTGCAGGCCATGCGTCTGGTATTACCTATGTTG
CAGTGACAAATGAGGGAGGCTCTGGAGATAAAACTCTTGAAGGTGTTCAAATTATTTCGACAGATTCTTC
TGATAAGAATGCTTTTATTCAGAAAGGCCGTATTGTTGCTGGTAGTTATGACTATCGCCTGAAACAGGGC
ACTGTATCTGGACTGAATACCAATAAGTGGTATCTAACTAGTCAGATGGATAATCAAGAATCAAAACAGA
TGAGCAATCAAGAGTCTACTCAAATGAGTAGTCGCCGAGCTAGTTCACAGCTTGTATCTTCACTTAATTT
GGGTGAAGGTAGTATTCACACATGGCGCCCTGAAGCTGGCAGTTATATTGCTAACCTGATAGCAATGAAC
ACGATGTTTAGTCCTTCTCTCTATGACCGACACGGTAGCACTATTGTTGATCCTACTACAGGTCAGCTCA
GCGAAACCACCATGTGGATTCGTACTGTTGGTGGACATAATGAGCATAATTTAGCTGATAGACAATTAAA
AACCACAGCTAACAGGATGGTTTATCAGATTGGTGGAGATATTTTGAAGACAAACTTCACTGATCATGAT
GGCTTGCATGTGGGTATTATGGGAGCTTATGGATATCAGGATAGCAAAACTCATAATAAGTATACTAGTT
ATAGTTCACGAGGAACTGTGAGCGGTTATACTGCCGGTTTGTACAGTTCTTGGTTTCAGAATGAAAAAGA
ACGAACAGGTCTATATATGGATGCTTGGTTGCAGTACGGTTGGTTTAATAATACAGTCAAAGGAGATGGG
TTAACTGGTGAGAAATATTCCAGCAAAGGAATAACAGGAGCTTTGGAAGCTGGCTATATCTACCCAACCA
TACGCTGGACTGCTCATAATAATATTGACAACGCATTGTATCTCAATCCACAAGTCCAGATAACTAGGCA
TGGGGTAAAAGCAAACGACTATATTGAACACAATGGCACTATGGTCACATCCTCTGGGGTCAATAATATT
CAAGCAAAATTGGGATTGCGTACATCCTTAATTAGTCAGAGTTGTATCGATAAGGAGACTCTTCGTAAGT
TCGAACCATTTTTGGAAGTGAATTGGAAATGGAGCTCAAAGCAATATGGTGTAATTATGAATGGCATGTC
AAATCACCAGATAGGCAACCGTAATGTGATTGAACTCAAAACTGGTGTGGGGGGGCGTCTTGCAGATAAC
CTAAGCATCTGGGGAAACGTATCTCAGCAATTGGGTAATAACAGTTACAGAGACACCCAAGGTATTTTGG
GTGTGAAATATACCTTCTG
Protein Sequence
>gi|74314980|ref|YP_313398.1| IcsA/VirG [Shigella sonnei Ss046]
MNQIHKFFCNMTQCSQGGAGELPTVKEKTCKLSFSPFVVGASLLLGGPIAFAIPLSGTQELHFSEDNYEK
LLTPVDGLSPLGAGEDGMDAWYITSSNPSHASRTKLRINSDIMISAGHGGAGDNNDGNSCGGNGGDSITG
SDLSIINQGMILGGNGGSGADHNGDGGEAVTGDNLFIINGEIISGGHGGDSYSDSDGGNGGDAVTGVNLP
IINKGTISGGNGGNNYGEGDGGNGGDAITGSSLSVINKGTFAGGNGGAAYGYGYDGYGGNAITGDNLSII
NNGAILGGNGGHWGDAINGSNMTIANSGYIISGKEDDGTQNVVGNAIHITGGNNSLILHEGSVITGDVQV
NNSSILKIINNDYTGTTPTIEGDLCAGDCTTVSLSGNKFTVSGDVSFGENSSLNLAGISSLEASGNMSFG
NNVKVEAIINNWAQKDYKLLSADKGITGFSVSNISIINPLLTTGAIDYTKSYISDQNKLIYGLSWNDTDG
DSHGEFNLKENAELTVSTILADNLSHHNINSWDGKSLTKSGEGTLILAEKNTYSGFTNINAGILKMGTVE
AMTRTAGVIVNKGATLNFSGMNQTVNTLLNSGTVLINNINAPFLPDPVIVTGNMTLEKNGHVILNNSSSN
VGQTYVQKGNWHGKGGILSLGAVLGNDNSKTDRLEIAGHASGITYVAVTNEGGSGDKTLEGVQIISTDSS
DKNAFIQKGRIVAGSYDYRLKQGTVSGLNTNKWYLTSQMDNQESKQMSNQESTQMSSRRASSQLVSSLNL
GEGSIHTWRPEAGSYIANLIAMNTMFSPSLYDRHGSTIVDPTTGQLSETTMWIRTVGGHNEHNLADRQLK
TTANRMVYQIGGDILKTNFTDHDGLHVGIMGAYGYQDSKTHNKYTSYSSRGTVSGYTAGLYSSWFQNEKE
RTGLYMDAWLQYGWFNNTVKGDGLTGEKYSSKGITGALEAGYIYPTIRWTAHNNIDNALYLNPQVQITRH
GVKANDYIEHNGTMVTSSGVNNIQAKLGLRTSLISQSCIDKETLRKFEPFLEVNWKWSSKQYGVIMNGMS
NHQIGNRNVIELKTGVGGRLADNLSIWGNVSQQLGNNSYRDTQGILGVKYTF
Molecule Role Virmugen
Molecule Role Annotation A virG mutant (WRSS1) is attenuated in guinea pigs and induced significant protection from challenge with wild type Shigella sonnei (Hartman and Venkatesan, 1998).
Related Vaccines(s) Shigella sonnei virG/senA/senB mutant vaccine , Shigella sonnei virG/senA/senB/msbB2 mutant vaccine
References