VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

GuaB

Gene Name GuaB
Sequence Strain (Species/Organism) Shigella flexneri 5 str. 8401
NCBI Gene ID 4207514
NCBI Protein GI 110806439
Locus Tag SFV_2555
Genbank Accession CP000266
Protein Accession YP_689959
Taxonomy ID 373384
Gene Starting Position 2617798
Gene Ending Position 2619270
Gene Strand (Orientation) -
Protein Name inosine 5'-monophosphate dehydrogenase
Protein pI 6.37
Protein Weight 47489.31
Protein Length 490
Protein Note catalyzes the synthesis of xanthosine monophosphate by the NAD+ dependent oxidation of inosine monophosphate
DNA Sequence
>NC_008258.1:2617798-2619270 Shigella flexneri 5 str. 8401, complete genome
ATCAGGAGCCCAGACGGTAGTTCGGGGACTCTTTAGTAATGGTCACGTCGTGAACGTGGCTTTCCTGAAT
GCCCGCACCGCTGATACGTACAAACTCCGCTTTAGTACGCAGTTCGTCGATAGTACCACAGCCGGTCAGA
CCCATACAGGAGCGCAGGCCGCCCATCTGCTGGTGAATGATCTCTTTCAGGCGACCTTTATAAGCTACGC
GACCTTCGATACCTTCCGGCACCAGTTTGTCGGCAGCGTTATCGCTCTGGAAATAACGGTCAGAGGAACC
TTTGGACATCGCGCCCAGGGAACCCATACCACGGTAAGATTTATAAGAACGGCCCTGGTAGAGTTCGATT
TCACCCGGAGATTCTTCAGTACCCGCCAGCATGGAACCTACCATCACCGCGCTTGCGCCAGCGGCGATAG
CTTTGGCGATGTCGCCGGAGAAGCGAATACCACCATCTGCGATAACCGGAATACCGGTGCCTTCCAGGGC
TTCAACTGCGTCAGCAACGGCAGTGATCTGCGGAACACCTACGCCAGTAACGATACGAGTCGTACAGATA
GAACCAGGGCCGATACCGACTTTAACCGCGCTGCAACCAGCTTCTGCCAAAGCGCGTGCACCTGCAGCTG
TTGCCACGTTGCCGCCGATGATTTGCAGATCCGGATATTTAGCACGGGTTTCACGGATACGCTGCAAAAC
GCCTTCTGAGTGACCGTGGGAGGAGTCGATCAGCAGAACGTCAACGCCAGCGGCAACCAGCGCGTCAACA
CGCTCTTCGTTACCCGCACCTGCGCCAACTGCAGCACCAACACGCAGACGGCCTTGCTCGTCTTTACAGG
CGTTCGGTTTACGTTCCGCTTTCTGGAAGTCTTTCACGGTGATCATGCCGATCAGGTGGAATTCGTCATC
AACCACCAGCGCTTTTTCAACGCGTTTTTCGTGCATTTTTGCCAGCACCACTTCACGGGCTTCACCTTCA
CGCACGGTGACCAGACGCTCTTTCGGCGTCATGTAAACGCTAACCGGCTGGTTCAGGTCGGTAACAAAAC
GCACGTCACGACCGGTGATAATACCCACCAGTTCGTTTTCTTCGGTAACGACCGGATAGCCCGCAAAACC
GTTACGCTCGGTCAGTTCTTTCACTTCGCGCAGCGTCGTGGTTGGCAGAACAGTCTGCGGATCAGTCACC
ACACCAGATTCGTGTTTTTTCACACGGCGAACTTCTTCTGCCTGGCGTTCAATGGACATGTTTTTGTGGA
TAAAGCCGATACCGCCTTCCTGAGCCAGAGCAATAGCCAGGCGCGCTTCCGTTACGGTATCCATTGCTGC
GGAAAGCATAGGGATATTCAGACGAATAGTTTTCGTCAGCTGGGTGCTGAGGTCAGCAGTATTCGGCAGA
ACGGTAGAATGAGCAGGAACGAGGAGAACGTCGTCAAACGTCAGAGCTTCTTTAGCGATACGTAGCATGG
GCA

Protein Sequence
>YP_689959.1 inosine 5'-monophosphate dehydrogenase [Shigella flexneri 5 str. 8401]
MPMLRIAKEALTFDDVLLVPAHSTVLPNTADLSTQLTKTIRLNIPMLSAAMDTVTEARLAIALAQEGGIG
FIHKNMSIERQAEEVRRVKKHESGVVTDPQTVLPTTTLREVKELTERNGFAGYPVVTEENELVGIITGRD
VRFVTDLNQPVSVYMTPKERLVTVREGEAREVVLAKMHEKRVEKALVVDDEFHLIGMITVKDFQKAERKP
NACKDEQGRLRVGAAVGAGAGNEERVDALVAAGVDVLLIDSSHGHSEGVLQRIRETRAKYPDLQIIGGNV
ATAAGARALAEAGCSAVKVGIGPGSICTTRIVTGVGVPQITAVADAVEALEGTGIPVIADGGIRFSGDIA
KAIAAGASAVMVGSMLAGTEESPGEIELYQGRSYKSYRGMGSLGAMSKGSSDRYFQSDNAADKLVPEGIE
GRVAYKGRLKEIIHQQMGGLRSCMGLTGCGTIDELRTKAEFVRISGAGIQESHVHDVTITKESPNYRLGS

Molecule Role Protective antigen
Related Vaccines(s) S. flexneri 2a strain CVD 1205
References