VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

AroA

Gene Name AroA
Sequence Strain (Species/Organism) Shigella flexneri 2a str. 2457T
NCBI Gene ID 1077373
NCBI Protein GI 30062442
Locus Tag S0967
Genbank Accession NC_004741.1
Protein Accession NP_836613.1
Taxonomy ID 620
Gene Starting Position 945133
Gene Ending Position 946416
Gene Strand (Orientation) +
Protein Name 3-phosphoshikimate 1-carboxyvinyltransferase
Protein pI 5.14
Protein Weight 46167.3
Protein Length 427
Protein Note catalyzes the formation of 5-O-(1-carboxyvinyl)-3-phosphoshikimate from phosphoenolpyruvate and 3-phosphoshikimate in tryptophan biosynthesis
DNA Sequence
>GeneID|1077373 [Shigella flexneri 2a str. 2457T ] 945133..946416
tacaacccatcgctcgtgtcgatggcactattaatctgcccggttccaagagcgtttctaaccgcgcttt
attgcttgcggcattagcacacggcaaaacagtattaaccaatctgctggatagcgacgacgtgcgccat
atgctgaatgcattaacagcgttagggttaagctatacgctttcagccgatcgtacgcgttgcgaaatta
tcggtaacggcggtccattacacgcagaaggtgccctggagttgttcctcggtaacgccggaacggcaat
gcgtccgctggcggcagctctttgtctggatagcaatgatattgtgctgaccggtgagccgcgtatgaaa
gagcgcccgattggtcatctggtggatgcgctgcgcctgggcggggcgaagatcacttacctggaacaag
aaaattatccgccgttgcgtttacagggcggctttactggcggcaacgttgacgttgatggctccgtttc
cagccaattcctcaccgcactgttaatgactgcgcctcttgcgccggaagatacggtgattcgtattaaa
ggcgatctggtttctaaaccttatatcgacatcacactcaatctgatgaagacgtttggtgttgaaattg
aaaatcagcactatcaacaatttgtcgtaaaaggcgggcagtcttatcagtctccgggtacttatttggt
cgaaggcgatgcatcttcggcttcttacttcctggcagcagcagcaatcaaaggcggcactgtaaaagtg
accggtattggacgtaacagtatgcagggtgatattcgctttgctgatgtgctggaaaaaatgggcgcga
ccatttgctggggcgatgattatatttcctgcacgcgtggtgaactgaacgctattgatatggatatgaa
ccatattcctgatgcggcgatgaccattgccacggcggcgttatttgcaaaaggcaccaccacgctgcgc
aatatctataactggcgtgttaaagagaccgatcgcctgtttgcgatggcaacagaactgcgtaaagtcg
gcgcggaagtggaagaggggcacgattacattcgtatcactcctccggaaaaactgaactttgccgagat
cgcgacatacaatgatcaccggatggcgatgtgtttctcgctggtggcgttgtcagatacaccagtgacg
attcttgatcccaaatgcacggccaaaacatttccggattatttcgagcagctggcgcggattagccagg
cagcctgaatgaacaacgggcaat
Protein Sequence
>gi|30062442|ref|NP_836613.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Shigella flexneri 2a str. 2457T ]
MESLTLQPIARVDGTINLPGSKSVSNRALLLAALAHGKTVLTNLLDSDDVRHMLNALTALGLSYTLSADR
TRCEIIGNGGPLHAEGALELFLGNAGTAMRPLAAALCLDSNDIVLTGEPRMKERPIGHLVDALRLGGAKI
TYLEQENYPPLRLQGGFTGGNVDVDGSVSSQFLTALLMTAPLAPEDTVIRIKGDLVSKPYIDITLNLMKT
FGVEIENQHYQQFVVKGGQSYQSPGTYLVEGDASSASYFLAAAAIKGGTVKVTGIGRNSMQGDIRFADVL
EKMGATICWGDDYISCTRGELNAIDMDMNHIPDAAMTIATAALFAKGTTTLRNIYNWRVKETDRLFAMAT
ELRKVGAEVEEGHDYIRITPPEKLNFAEIATYNDHRMAMCFSLVALSDTPVTILDPKCTAKTFPDYFEQL
ARISQAA
Molecule Role Virmugen
Molecule Role Annotation An aroA and virG mutant (CVD 1203) is attenuated in guinea pigs, as shown by the Sereny test. Guinea pigs inoculated with CVD 1203 were also protected from challenge with wild type S. flexneri (Noriega et al., 1994).
Related Vaccines(s) CVD 1204(pGA1-CS2) , S. dysenteriae 1 strain WRSd1 , S. flexneri 2a strain CVD 1203 , S. sonnei strain WRSS1
References