VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

AroD

Gene Name AroD
Sequence Strain (Species/Organism) Shigella flexneri 2a str. 2457T
NCBI Gene ID 1078189
NCBI Protein GI 30063207
Locus Tag S1855
Genbank Accession NC_004741.1
Protein Accession NP_837378.1
Taxonomy ID 620
Gene Starting Position 1794511
Gene Ending Position 1795269
Gene Strand (Orientation) +
Protein Name 3-dehydroquinate dehydratase
Protein pI 5.17
Protein Weight 27517.5
Protein Length 252
Protein Note catalyzes the dehydration of 3-dehydroquinate to form 3-dehydroshikimate in aromatic amino acid biosynthesis
DNA Sequence
>GeneID|1078189 [Shigella flexneri 2a str. 2457T ] 1794511..1795269
tcgtcattggtgcgggcgcacctaaaatcatcgtctcgctgatggcgaaagatatcgcccgcgtgaaatc
cgaagctctcgcctatcgtgaagcggactttgatattctggaatggcgtgtggaccactttgccgacctc
tccaatgtggagtctgtcatggcggcggcaaaaattctccgtgaaaccatgccagaaaaaccgctgctgt
ttaccttccgcagtgccaaagaaggcggcgagcaggcgatttccaccgaggcttatattgctctcaatcg
tgcagccatcgacagcggcctggttgatatgatcgatctggagttatttaccggcgatgatcaggtcaaa
gaaaccgtcgcctacgcccacgcgcatgatgtgaaagttgtcatgtccaaccatgacttccataaaacgc
cggaagccgaagaaatcattgcccgtctgcgcaaaatgcagtccttcgacgccgatattcctaagattgc
gctgatgccgcaaagtaccagcgatgtgctgacgttgcttgccgcgaccctggagatgcaggagcagtat
gccgatcgtccaatcatcacgatgtcgatggcaaaaactggcgtaatttctcgtctggttggtgaagtat
ttggctcggcggcaacttttggtgcggtaaaaaaagcctctgcgccagggcaaatctcggtaaatgattt
gcgcacggtattaactattttacatcaggcataagcaataatatttcggcggaaatacc
Protein Sequence
>gi|30063207|ref|NP_837378.1| 3-dehydroquinate dehydratase [Shigella flexneri 2a str. 2457T ]
MKTVTVKDLVIGAGAPKIIVSLMAKDIARVKSEALAYREADFDILEWRVDHFADLSNVESVMAAAKILRE
TMPEKPLLFTFRSAKEGGEQAISTEAYIALNRAAIDSGLVDMIDLELFTGDDQVKETVAYAHAHDVKVVM
SNHDFHKTPEAEEIIARLRKMQSFDADIPKIALMPQSTSDVLTLLAATLEMQEQYADRPIITMSMAKTGV
ISRLVGEVFGSAATFGAVKKASAPGQISVNDLRTVLTILHQA
Molecule Role Virmugen
Molecule Role Annotation An aroD mutant is highly attenuated in monkeys and induces significant protection from challenge with wild type S. flexneri (Kärnell et al., 1993).
Related Vaccines(s) S. flexneri strain Sfl 124 , Shigella flexneri aroD mutant vaccine
References