VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

znuA

Gene Name znuA
Sequence Strain (Species/Organism) Brucella melitensis biovar Abortus 2308
VO ID VO_0012365
NCBI Gene ID 3827700
NCBI Protein GI 83269918
Locus Tag BAB2_1079
Genbank Accession AM040265
Protein Accession YP_419209
Taxonomy ID 359391
Chromosome No II
Gene Starting Position 1063213
Gene Ending Position 1064217
Gene Strand (Orientation) -
Protein Name periplasmic solute binding protein
Protein pI 6.31
Protein Weight 33961.81
Protein Length 334
Protein Note similar to BRA1122, zinc ABC transporter, periplasmic zinc-bnding protein
DNA Sequence
>gi|83268957:1063213-1064217 Brucella melitensis biovar Abortus 2308 chromosome chromosome II, complete sequence
TTTATTTCGGCAGGCAGTCTTTCAGCGAATTGGCCAGATTGCGGATGAGTTGCGGATAAAGATCAGGGCC
GTCCTTCAGTTCTGCGCCAAGAGGATCAAGAACACCTGTCCGGGCTTTCGTTCCGTCAACCACCGTCTTC
ACCAGTTTCGGCTCAAATTGCGGCTCTGAGAAAACGCAGGTTGCACCGAGTGACTTTATCTTGTCGTGAA
TTTGCTGGATACGCGCCGCACCCGGCGCTTTTTCCGGGCTGACCGTGATGGAGCCGGCTGCTTTCATGCC
GAAGCGATTCTCGAAATATTGATAGGCATCATGAAAGACGATGAAGGGCTTGTCCTTGACCGGCTTCAGT
TCAGCAGCCACTTCCCTGGTCAAGGCATCGAGTTTTTCTCCATAGGCCTTGGCATTCTTTTCATATTGCG
CGGCGTGTTCCGGGTCGCTCTCGCCAAGCGTTTTGGCGATATCGGCAGCCAGAATCTTGCCATTTTGCGG
GTCAAGCCAGAAATGCAGATCATATTCGCCGTGATGGTGGTGTTCATGGCCTTCTTCTGCGACTTCGGCC
GCATGGTCGTGATCGCCTGAACCATGTGCGTCATGCTCTTCCTCATGGCTCCCCCCATGGCCATGATCGT
GCGCCTCGAACGGCCCACCCTCGCGGAATTTTAGTTTCGTCAACCCTTTCGCATCGCCAAGAGCCACCAC
TTTCGCGCCCTCGCCCAGCGTATCAATGGGCTTGTCGAGAAAGGTTTCCATGGATGGCCCGGCCCAGAAA
ATCACCTTGGCGTGCTCGATAGCCTCGGCATCGGAGGGTTTCAGACTATAAACATGCTCGGACCCAGCCC
CCTGAACGATCAGCTTCGGCTTACCCACGCCCTGCATGACGGCGGAAACAATCGAGTGAAGCGGCTTGAT
CGAAACAACCACGCCCTCACGTTCGCCTGCAAGGGAAGAACCGCAAAAGCCAGCCAGAAAGGCAGAAGCA
AGAAACAAGGAATGCAGATTTTTCA
Protein Sequence
>gi|83269918|ref|YP_419209.1| periplasmic solute binding protein [Brucella melitensis biovar Abortus 2308]
MKNLHSLFLASAFLAGFCGSSLAGEREGVVVSIKPLHSIVSAVMQGVGKPKLIVQGAGSEHVYSLKPSDA
EAIEHAKVIFWAGPSMETFLDKPIDTLGEGAKVVALGDAKGLTKLKFREGGPFEAHDHGHGGSHEEEHDA
HGSGDHDHAAEVAEEGHEHHHHGEYDLHFWLDPQNGKILAADIAKTLGESDPEHAAQYEKNAKAYGEKLD
ALTREVAAELKPVKDKPFIVFHDAYQYFENRFGMKAAGSITVSPEKAPGAARIQQIHDKIKSLGATCVFS
EPQFEPKLVKTVVDGTKARTGVLDPLGAELKDGPDLYPQLIRNLANSLKDCLPK
Molecule Role Virmugen
Additional Molecule Role Virmugen
Additional Molecule Role Annotation Deletion of gene znuA attenuates Brucella abortus and this live attenuated vaccine was challenged in mice. These mice showed significantly fewer spenic CFU (Yang et al., 2006).
Related Vaccines(s) Live attenuated B. abortus with deletion of znuA
References