VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

VjbR

Gene Name VjbR
Sequence Strain (Species/Organism) Brucella melitensis 16M
NCBI Gene ID 1198888
NCBI Protein GI 17989461
Locus Tag BMEII1116
Genbank Accession NC_003318
Protein Accession NP_542094
Taxonomy ID 224914
Chromosome No II
Gene Starting Position 1150819
Gene Ending Position 1151526
Gene Strand (Orientation) -
Protein Name TRANSCRIPTIONAL ACTIVATOR, LUXR FAMILY
Protein pI 6.65
Protein Weight 23978.21
Protein Length 235
DNA Sequence
>gi|1198888|gb|N56040.1|N56040 J6249F Human fetal heart, Lambda ZAP Express Homo sapiens cDNA clone J6249 5', mRNA sequence
GTGAACATTTTAGACACCTTTTCTTTGGGTAGGCTCTTGCCCAGGCGCCGGCTCTTCTCCCAAAAAAAAA
AAAAACCTTATCCTTTCCCTAACCTGATAACCTCCAGATCCAGGGTTTCTAACTAAGTGAGTCTTTGAAG
TATTAAGGGACATGAATAGCT
Protein Sequence
>gi|17989461|ref|NP_542094.1| TRANSCRIPTIONAL ACTIVATOR, LUXR FAMILY [Brucella melitensis 16M]
MALLTRIRDEIGCRYVTHTYRGRVGDCTKVNSADLTVLMTLPATWVARYSSKNYFAIDPVFQEDAPYYRN
DTSAIARDLKEDADICPAVAELLHDAEKHGLGNLFIAVSARNPKGVAGCTVFTFEVEDEDRTQFLARMRP
RLLSLAGIIHGTVCGCKDANSVASLLTPREVDCLRWAANGKTDGEIAEILSIARWTVVTYLQNAKIKLNC
SNRTSAVATALSLGIIDMPEVQHLV
Molecule Role Virmugen
Molecule Role Annotation The deletion of vjbR gene in Brucella melitensis strain 16M made a live attenuated vaccine and provided significance protection against mice (Wang et al., 2011).
Related Vaccines(s) Brucella abortus S19 vjbR mutant vaccine , Microencapsulated B. melitensis vjbR mutant vaccine
References