VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

purK

Gene Name purK
Sequence Strain (Species/Organism) Brucella melitensis bv. 1 str. 16M
NCBI Protein GI 20141763
Other Database IDs CDD:180352
CDD:200773
CDD:194530
Taxonomy ID 224914
Chromosome No I
Gene Strand (Orientation) ?
Protein Name N5-carboxyaminoimidazole ribonucleotide synthase
Protein Length 362
Protein Note biovar: 1 str. 16M
DNA Sequence
>gi|3788877|gb|AQ262397.1|AQ262397 CITBI-E1-2502P3.TF CITBI-E1 Homo sapiens genomic clone 2502P3, DNA sequence
CACCACCCCCCAGCCTGAGACCAAAGTCACAGTTTAACTCTGTCATGGGTCATGTGCAGAGGGAAGGGAC
TGCCCCAGAATTAGCAGTTGGCTGAACACCCTGCTTAAAAACTTTTTCTTTTCCTTTTTTTGTGAGTACC
GTCCGCTTGGACTAAAGAAGTTTTGGTTCGTTGTTTTCTTAATTTTGGGCTACAGAGTCTCTACCTACAT
TTGTGTTTTGTGTTTTGGTAACCACATGTAACAGCCGGTGGAATCTTTTTTCTCTTTGCTTTCTCTGAAC
TTTTCAAAGAGTAGGCCCCTATCTTTCGGGGGATTAACTCCTTGTGGCCCCTGTGTCGTTGGTGCT
Protein Sequence
>gi|20141763|sp|P52559.2|PURK_BRUME RecName: Full=N5-carboxyaminoimidazole ribonucleotide synthase; Short=N5-CAIR synthase; AltName: Full=5-(carboxyamino)imidazole ribonucleotide synthetase
MDKTSLKPGSTIGIIGGGQLGRMLAMAAARFGYETIILEPQAGCPAAQVANRQIVAAYDDPKALAELAAA
SDVITYEFENVPVSAADKLAETALVLPPPAALEISQDRFTEKQFLNESGIETAPWRLVDDEETLIAALGA
LGGRGILKIRRLGYDGKGQVRLASLDETQACNAFAAINKAPAILEGFVEFEREVSVIAARDRSGNVAIFD
LAENVHKDGILATSTVPAAISVQTAEAARTAAEKLLHALDYVGVLGLEFFVLKDGTLLANEFAPRVHNSG
HWTEAACAISQFEQHIRAVAGLPLGNTDRHSDCVMENLIGDDIEKVPAILCEKNAVLHLYGKKEARAGRK
IGHVTRIKPRTI
Molecule Role Virmugen
Molecule Role Annotation A purE/purK mutant of B. melitensis 16M was attenuated in mice when given intraperitoneally. Nine weeks after immunization, mice were protected from challenge with wild type B. melitensis (Drazek et al., 1995).
Related Vaccines(s) B. melitensis WR201 (16MĪ”purEK)
References