VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

LcrV from Y. pestis biovar Microtus str. 91001

Gene Name LcrV from Y. pestis biovar Microtus str. 91001
Sequence Strain (Species/Organism) Yersinia pestis biovar Microtus str. 91001
NCBI Gene ID 2767532
Locus Tag YP_pCD52
3D structure: PDB ID 1R6F
DNA Sequence
>gi|45357124:37960-38934 Yersinia pestis biovar Microtus str. 91001 plasmid pCD1, complete sequence
ATGATTAGAGCCTACGAACAAAACCCACAACATTTTATTGAGGATCTAGAAAAAGTTAGGGTGGAACAAC
TTACTGGTCATGGTTCTTCAGTTTTAGAAGAATTGGTTCAGTTAGTCAAAGATAAAAATATAGATATTTC
CATTAAATATGATCCCAGAAAAGATTCGGAGGTTTTTGCCAATAGAGTAATTACTGATGATATCGAATTG
CTCAAGAAAATCCTAGCTTATTTTCTACCCGAGGATGCCATTCTTAAAGGCGGTCATTATGACAACCAAC
TGCAAAATGGCATCAAGCGAGTAAAAGAGTTCCTTGAATCATCGCCGAATACACAATGGGAATTGCGGGC
GTTCATGGCAGTAATGCATTTCTCTTTAACCGCCGATCGTATCGATGATGATATTTTGAAAGTGATTGTT
GATTCAATGAATCATCATGGTGATGCCCGTAGCAAGTTGCGTGAAGAATTAGCTGAGCTTACCGCCGAAT
TAAAGATTTATTCAGTTATTCAAGCCGAAATTAATAAGCATCTGTCTAGTAGTGGCACCATAAATATCCA
TGATAAATCCATTAATCTCATGGATAAAAATTTATATGGTTATACAGATGAAGAGATTTTTAAAGCCAGC
GCAGAGTACAAAATTCTCGAGAAAATGCCTCAAACCACCATTCAGGTGGATGGGAGCGAGAAAAAAATAG
TCTCGATAAAGGACTTTCTTGGAAGTGAGAATAAAAGAACCGGGGCGTTGGGTAATCTGAAAAACTCATA
CTCTTATAATAAAGATAATAATGAATTATCTCACTTTGCCACCACCTGCTCGGATAAGTCCAGGCCGCTC
AACGACTTGGTTAGCCAAAAAACAACTCAGCTGTCTGATATTACATCACGTTTTAATTCAGCTATTGAAG
CACTGAACCGTTTCATTCAGAAATATGATTCAGTGATGCAACGTCTGCTAGATGACACGAGGTAA
Protein Sequence
>gi|45357175:1-324 V antigen LcrV [Yersinia pestis biovar Microtus str. 91001]
MIRAYEQNPQHFIEDLEKVRVEQLTGHGSSVLEELVQLVKDKNIDISIKYDPRKDSEVFANRVITDDIEL
LKKILAYFLPEDAILKGGHYDNQLQNGIKRVKEFLESSPNTQWELRAFMAVMHFSLTADRIDDDILKVIV
DSMNHHGDARSKLREELAELTAELKIYSVIQAEINKHLSSSGTINIHDKSINLMDKNLYGYTDEEIFKAS
AEYKILEKMPQTTIQVDGSEKKIVSIKDFLGSENKRTGALGNLKNSYSYNKDNNELSHFATTCSDKSRPL
NDLVSQKTTQLSDITSRFNSAIEALNRFIQKYDSVMQRLLDDTR
Related Vaccines(s) Recombinant Y. pestis V antigen vaccine , Y. pestis DNA vaccine F1-V DNA
References