VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

PhoP

Gene Name PhoP
Sequence Strain (Species/Organism) Mycobacterium tuberculosis H37Rv
NCBI Gene ID 888772
NCBI Protein GI 15607897
Locus Tag Rv0757
Genbank Accession BX842574
Protein Accession NP_215271
3D structure: PDB ID 3R0J
Taxonomy ID 83332
Gene Starting Position 851607
Gene Ending Position 852350
Gene Strand (Orientation) ?
Protein Name two component system response transcriptional positive regulator PHOP
Protein pI 6.31
Protein Weight 24835.35
Protein Length 247
Protein Note Rv0757, (MTCY369.02), len: 247 aa. Possible phoP, two component system response phosphate regulon transcriptional regulator (see citations below), highly similar to various transcriptional regulators e.g. CAC32360.1|AL583945 putative two component system response regulator from Streptomyces coelicolor (271 aa); T45446 probable two-component response regulator from Mycobacterium leprae (253 aa); and similar to phoP proteins e.g. P13792|PHOP_BACSU alkaline phosphatase synthesis transcription regulatory protein from Bacillus subtilis (240 aa), FASTA scores: opt: 594, E(): 2.3e-33, (41.0% identity in 234 aa overlap); etc. Also highly similar to Rv3765c from Mycobacterium tuberculosis (234 aa), Rv1033c (257 aa), RV0903c|MTCY31.31c|Q10531 (236 aa), FASTA score: (45.4% identity in 229 aa overlap); MTCY10G2_16 and MTU88959_1.
DNA Sequence
>gi|57116681:851607-852350 Mycobacterium tuberculosis H37Rv, complete genome
AATGCGGAAAGGGGTTGATCTCGTGACGGCGGGAACCCCAGGCGAAAACACCACACCGGAGGCTCGTGTC
CTCGTGGTCGATGATGAGGCCAACATCGTTGAACTGCTGTCGGTGAGCCTCAAGTTCCAGGGCTTTGAAG
TCTACACCGCGACCAACGGGGCACAGGCGCTGGATCGGGCCCGGGAAACCCGGCCGGACGCGGTGATCCT
CGATGTGATGATGCCCGGGATGGACGGCTTTGGGGTGCTGCGCCGGCTGCGCGCCGACGGCATCGATGCC
CCGGCGTTGTTCCTGACGGCCCGTGACTCGCTACAGGACAAGATCGCGGGTCTGACCCTGGGTGGTGACG
ACTATGTGACAAAGCCCTTCAGTTTGGAGGAGGTCGTGGCCAGGCTGCGGGTCATCCTGCGACGCGCGGG
CAAGGGCAACAAGGAACCACGTAATGTTCGACTGACGTTCGCCGATATCGAGCTCGACGAGGAGACCCAC
GAAGTGTGGAAGGCGGGCCAACCGGTGTCGCTGTCGCCCACCGAATTCACCCTGCTGCGCTATTTCGTGA
TCAACGCGGGCACCGTGCTGAGCAAGCCTAAGATTCTCGACCACGTTTGGCGCTACGACTTCGGTGGTGA
TGTCAACGTCGTCGAGTCCTACGTGTCGTATCTGCGCCGCAAGATCGACACTGGGGAGAAGCGGCTGCTG
CACACGCTGCGCGGGGTGGGCTACGTACTGCGGGAGCCTCGATG
Protein Sequence
>gi|15607897|ref|NP_215271.1| two component system response transcriptional positive regulator PHOP [Mycobacterium tuberculosis H37Rv]
MRKGVDLVTAGTPGENTTPEARVLVVDDEANIVELLSVSLKFQGFEVYTATNGAQALDRARETRPDAVIL
DVMMPGMDGFGVLRRLRADGIDAPALFLTARDSLQDKIAGLTLGGDDYVTKPFSLEEVVARLRVILRRAG
KGNKEPRNVRLTFADIELDEETHEVWKAGQPVSLSPTEFTLLRYFVINAGTVLSKPKILDHVWRYDFGGD
VNVVESYVSYLRRKIDTGEKRLLHTLRGVGYVLREPR
Molecule Role Virmugen
Molecule Role Annotation Study evaluated immunogenicity and protection against Mycobacterium tuberculosis in rhesus monkeys with an attenuated M. tuberculosis with a disrupted phoP gene (SO2) as a single-dose vaccine. SO2 treatment showed reduced average lung bacterial counts (1.0 and 1.2 log respectively, compared with 0.4 log for BCG) and significant protective effect by reduction in C-reactive protein levels, body weight loss, and decrease of erythrocyte-associated hematologic parameters (MCV, MCH, Hb, Ht) as markers of inflammatory infection, all relative to non-vaccinated controls (Verreck et al., 2009).
Related Vaccines(s) M. tuberculosis phoP mutant SO2
References