VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

Hma

Gene Name Hma
Sequence Strain (Species/Organism) Escherichia coli CFT073
VO ID VO_0010984
NCBI Gene ID 1037732
NCBI Protein GI 26248334
Locus Tag c2482
Genbank Accession AE014075
Protein Accession NP_754374
Taxonomy ID 199310
Gene Starting Position 2322323
Gene Ending Position 2324470
Gene Strand (Orientation) +
Protein Name outer membrane receptor for iron compound or colicin
Protein pI 5.31
Protein Weight 75008.63
Protein Length 715
Protein Note Escherichia coli O157:H7 ortholog: z3159
DNA Sequence
>NC_004431.1:2322323-2324470 Escherichia coli CFT073, complete genome
AATGTTATATAATATACCTTGTCGAATTTATATCCTTTCCACTCTGTCATTATGCATTTCTGGGATAGTT
TCTACTGCAACCGCAACTTCTTCAGAAACAAAAATCAGCAACGAAGAGACGCTCGTCGTGACCACGAATC
GTTCGGCAAGCAACCTTTGGGAAAGCCCGGCGACTATACAGGTTATTGACCAACAAACATTGCAGAACTC
CACCAATGCCTCCATAGCCGATAATTTGCAGGACATCCCCGGAGTAGAGATAACAGACAACTCCTTGGCA
GGCCGTAAACAAATCCGCATTCGTGGCGAAGCATCCTCCCGTGTTTTAATTCTCATTGATGGTCAGGAGG
TAACTTATCAGCGCGCCGGAGATAATTATGGTGTGGGACTGTTGATAGATGAGTCTGCGCTGGAGCGTGT
TGAGGTAGTGAAAGGTCCATATTCCGTACTGTACGGTTCACAGGCAATTGGCGGTATTGTTAACTTCATA
ACCAAAAAGGGAGGTGACAAACTTGCATCTGGAGTTGTGAAAGCTGTTTATAATTCCGCAACAGCAGGCT
GGGAAGAATCAATCGCGGTCCAGGGGAGCATCGGTGGATTTGATTATCGCATCAACGGTAGTTATTCTGA
TCAGGGCAATCGTGATACGCCGGATGGACGTCTGCCGAATACCAACTATCGTAACAATAGTCAGGGTGTA
TGGTTGGGTTATAACTCCGGAAACCATCGTTTTGGCCTCTCGCTTGATCGCTACAGACTCGCGACGCAAA
CTTACTATGAGGATCCAGACGGAAGCTATGAGGCATTTAGTGTCAAAATACCTAAACTTGAACGAGAGAA
AGTTGGGGTATTCTATGACACAGACGTGGACGGTGACTATCTAAAAAAAATTCATTTCGACGCGTATGAG
CAGACCATCCAGCGCCAATTTGCCAACGAAGTAAAAACGACACAGCCTGTTCCCAGTCCGATGATTCAGG
CTCTGACCGTTCATAACAAGACTGACACCCATGATAAGCAATACACTCAGGCGGTCACATTGCAGAGTCA
CTTTTCGCTGCCTGCTAATAATGAACTTGTTACCGGTGCACAGTACAAACAAGACAGGGTCAGCCAAAGG
TCCGGTGGCATGACCTCAAGCAAATCTCTGACCGGCTTCATTAATAAGGAAACACGAACTCGCTCCTATT
ATGAGTCAGAGCAAAGTACAGTCTCACTATTCGCACAAAATGACTGGCGATTCGCCGATCACTGGACATG
GACAATGGGAGTTCGCCAATACTGGCTTTCTTCAAAGTTGACGCGTGGTGACGGAGTATCATATACCGCA
GGCATTATAAGCGATACCTCTCTTGCCAGAGAGTCTGCGAGTGATCACGAAATGGTAACATCTACAAGCC
TGCGCTATTCAGGTTTCGATAACTTGGAGTTACGCGCTGCGTTCGCGCAAGGCTACGTATTTCCCACACT
CTCCCAGCTTTTTATGCAGACATCTGCGGGCGGCAGTGTCACATACGGAAATCCTGATCTTAAGGCTGAA
CACTCCAATAACTTTGAATTAGGTGCACGATATAATGGTAATCAGTGGCTGATTGACAGCGCAGTTTACT
ACTCAGAAGCTAAAGATTATATTGCAAGTCTGATCTGTGATGGCAGTATAGTTTGCAATGGTAACACCAA
CTCCTCCCGTAGTAGCTACTATTATTATGACAATATTGATCGGGCAAAAACATGGGGACTGGAAATAAGC
GCGGAATATAATGGCTGGGTTTTCTCGCCATATATCAGTGGCAATTTAATTCGTCGGCAATATGAAACTT
CAACATTAAAAACAACTAATACAGGAGAACCAGCGATAAACGGACGTATAGGGCTGAAACATACTCTTGT
GATGGGTCAGGCCAACATAATCTCTGATGTTTTTATTCGTGCTGCCTCTAGTGCAAAAGATGACAGTAAC
GGTACCGAAACAAATGTTCCGGGCTGGGCCACTCTCAACTTTGCAGTAAATACAGAATTCGGTAACGAGG
ATCAGTACCGGATTAACCTAGCACTCAATAACCTGACAGACAAACGCTACCGTACAGCACATGAAACTAT
TCCTGCAGCAGGTTTTAATGCAGCTATAGGTTTTGTATGGAATTTCTG

Protein Sequence
>NP_754374.1 outer membrane receptor for iron compound or colicin [Escherichia coli CFT073]
MLYNIPCRIYILSTLSLCISGIVSTATATSSETKISNEETLVVTTNRSASNLWESPATIQVIDQQTLQNS
TNASIADNLQDIPGVEITDNSLAGRKQIRIRGEASSRVLILIDGQEVTYQRAGDNYGVGLLIDESALERV
EVVKGPYSVLYGSQAIGGIVNFITKKGGDKLASGVVKAVYNSATAGWEESIAVQGSIGGFDYRINGSYSD
QGNRDTPDGRLPNTNYRNNSQGVWLGYNSGNHRFGLSLDRYRLATQTYYEDPDGSYEAFSVKIPKLEREK
VGVFYDTDVDGDYLKKIHFDAYEQTIQRQFANEVKTTQPVPSPMIQALTVHNKTDTHDKQYTQAVTLQSH
FSLPANNELVTGAQYKQDRVSQRSGGMTSSKSLTGFINKETRTRSYYESEQSTVSLFAQNDWRFADHWTW
TMGVRQYWLSSKLTRGDGVSYTAGIISDTSLARESASDHEMVTSTSLRYSGFDNLELRAAFAQGYVFPTL
SQLFMQTSAGGSVTYGNPDLKAEHSNNFELGARYNGNQWLIDSAVYYSEAKDYIASLICDGSIVCNGNTN
SSRSSYYYYDNIDRAKTWGLEISAEYNGWVFSPYISGNLIRRQYETSTLKTTNTGEPAINGRIGLKHTLV
MGQANIISDVFIRAASSAKDDSNGTETNVPGWATLNFAVNTEFGNEDQYRINLALNNLTDKRYRTAHETI
PAAGFNAAIGFVWNF

Molecule Role Protective antigen
Molecule Role Annotation A vaccine made by Hma from E. coli strain CFT073 and 536 induced protection to the infection of virulent strain CFT073 and 536, respectively, in the bladder in the CBA/J mice. (Alteri et al., 2009).
Related Vaccines(s) E. coli Hma protein vaccine
References