VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

NmpC

Gene Name NmpC
Sequence Strain (Species/Organism) Salmonella enterica subsp. enterica serovar Typhimurium
NCBI Protein GI 517159
Other Database IDs CDD:174088
Taxonomy ID 90371
Gene Strand (Orientation) ?
Protein Name NmpC protein
Protein Length 282
Protein Note synonym: Salmonella typhimurium
Protein Sequence
>gi|517159|dbj|BAA05056.1| NmpC protein [Salmonella enterica subsp. enterica serovar Typhimurium]
EFKGNRTESQGADKDKTRLAFAGLKFADYGSFDYGRNYGVAYDIGAWTDVLPEFGGDTWTQTDVFMTGRT
TGVATYRKTDFFGLVEGLNFAAQYQGKNDRDGAYESNGDGFGLSATYEYEGFGVGAAYAKSDRTNNQVKA
ASNLNAAGKNAEVWAAGLKYDANNIYLATTYSETLNMTFGEDAAGDAFIANKTQNFEAVAQYQFDFGLRP
SIAYLKSKGKNLGTYGDQDLVEYIDVGATYYFNKNMSTFVDYKINLLDDSDFTKAAKVSTDNIVAVGLNY
QF
Molecule Role Virmugen
Molecule Role Annotation In a pig infection experiment including two oral immunizations with SalmoporcDeltaompD (OmpD, nmpC) and challenge with a multiresistant S. enterica serovar Typhimurium DT104 clinical isolate, we confirmed the protective efficacy of SalmoporcDeltaompD in pigs, showing a significant reduction of both clinical symptoms and colonization of lymph nodes and intestinal tract (Selke et al., 2007).
Related Vaccines(s) Salmonella Typhimurium ompD/nmpC mutant vaccine
References