VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

RPVgp6 H

Gene Name RPVgp6 H
Sequence Strain (Species/Organism) Rinderpest virus (strain Kabete O)
NCBI Gene ID 3021774
NCBI Protein GI 56410435
Locus Tag RPVgp6
Genbank Accession X98291
Protein Accession YP_087125
Taxonomy ID 11242
Gene Starting Position 7258
Gene Ending Position 9087
Gene Strand (Orientation) +
Protein Name H protein
Protein pI 7.04
Protein Weight 63930.13
Protein Length 609
DNA Sequence
>NC_006296.2:7258-9087 Rinderpest virus (strain Kabete O), complete genome
CATGTCTCCCCCAAGAGACAGGGTCGACGCTTACTACAAGGACAACTTCCAATTCAAGAACACTCGGGTG
GTTCTTAATAAAGAGCAGCTCCTGATAGAGAGACCTTGCATGTTGCTGACGGTGTTGTTTGTCATGTTCC
TGAGTCTAGTCGGGCTATTAGCTATCGCAGGTATCAGACTCCATCGAGCTGCTGTCAATACAGCAAAAAT
CAACAATGACCTGACAACAAGTATTGATATTACCAAATCCATTGAGTACCAGGTCAAGGATGTTTTAACT
CCACTCTTCAAAATAATTGGAGATGAGGTCGGGTTGAGGACGCCTCAGAGATTCACAGATCTGACTAAAT
TCATATCAGACAAGATCAAGTTCCTTAACCCTGATAAGGAGTACGACTTTAGAGATATCAACTGGTGCAT
CAACCCTCCAGAGAGAATTAAGATTGATTATGATCAGTATTGTGCTCACACAGCAGCTGAGGATCTGATA
ACAATGCTTGTCAATTCATCCTTAACAGGGACTACAGTACTCCGCACGTCATTAGTCAACTTGGGGAGGA
ACTGTACTGGACCCACAACCACTAAGGGTCAGTTCTCTAATATATCATTGACCCTTTCCGGGATATACTC
AGGTCGTGGCTACAACATTTCATCTATGATCACTATTACTGGGAAAGGCATGTACGGGAGCACTTATCTG
GTCGGGAAATACAATCAAAGAGCCAGGAGGCCAAGCATAGTATGGCAACAGGATTACCGAGTCTTCGAAG
TAGGCATAATTAGAGAACTAGGAGTGGGCACACCAGTGTTTCATATGACAAACTACCTGGAACTTCCAAG
ACAGCCGGAATTGGAGACTTGCATGCTAGCCCTAGGAGAGTCCAAATTAGCTGCCCTCTGCCTAGCTGAC
AGCCCCGTCGCACTGCACTACGGGAGGGTAGGAGACGACAACAAGATCAGATTTGTCAAATTGGGAGTAT
GGGCATCACCGGCCGACCGAGACACTTTGGCCACTCTTTCAGCAATAGACCCGACATTGGACGGACTCTA
TATCACAACTCATAGGGGGATCATAGCTGCAGGGACTGCCATATGGGCTGTCCCTGTGACGAGAACAGAT
GACCAAGTGAAAATGGGAAAGTGCCGCCTAGAGGCTTGTCGAGACAGACCACCACCTTTCTGTAACAGTA
CAGATTGGGAGCCACTAGAGGCTGGCCGAATACCGGCGTATGGAGTACTAACCATCAAACTAGGGCTGGC
TGATGAGCCTAAAGTTGACATAATTTCAGAATTTGGTCCTCTAATCACCCATGACTCAGGGATGGATTTA
TACACCTCATTTGACGGTACCAAGTACTGGTTGACTACTCCTCCATTGCAGAACTCAGCTCTAGGAACTG
TGAACACCCTAGTTTTAGAGCCCAGTCTCAAAATTAGTCCTAACATCCTTACTCTCCCCATCAGGTCGGG
AGGGGGTGACTGTTATACTCCTACTTACCTGTCAGACCGGGCTGACGATGATGTTAAATTGAGCTCCAAT
CTTGTAATCCTCCCAAGTAGGGACCTCCAATATGTGTCTGCAACCTACGACATCTCCAGAGTTGAACATG
CCATTGTGTACCACATCTATAGTACCGGGCGACTATCATCGTATTACTACCCTTTCAAGTTGCCCATAAA
GGGAGATCCTGTCAGTCTGCAGATCGAATGCTTCCCGTGGGACCGCAAACTGTGGTGCCATCATTTCTGC
TCTGTTATAGATTCAGGGACTGGTGAGCAGGTCACCCATATAGGGGTAGTAGGGATTGAGATCACTTGCA
ATGGGAAATA

Protein Sequence
>YP_087125.2 H protein [Rinderpest virus (strain Kabete O)]
MSPPRDRVDAYYKDNFQFKNTRVVLNKEQLLIERPCMLLTVLFVMFLSLVGLLAIAGIRLHRAAVNTAKI
NNDLTTSIDITKSIEYQVKDVLTPLFKIIGDEVGLRTPQRFTDLTKFISDKIKFLNPDKEYDFRDINWCI
NPPERIKIDYDQYCAHTAAEDLITMLVNSSLTGTTVLRTSLVNLGRNCTGPTTTKGQFSNISLTLSGIYS
GRGYNISSMITITGKGMYGSTYLVGKYNQRARRPSIVWQQDYRVFEVGIIRELGVGTPVFHMTNYLELPR
QPELETCMLALGESKLAALCLADSPVALHYGRVGDDNKIRFVKLGVWASPADRDTLATLSAIDPTLDGLY
ITTHRGIIAAGTAIWAVPVTRTDDQVKMGKCRLEACRDRPPPFCNSTDWEPLEAGRIPAYGVLTIKLGLA
DEPKVDIISEFGPLITHDSGMDLYTSFDGTKYWLTTPPLQNSALGTVNTLVLEPSLKISPNILTLPIRSG
GGDCYTPTYLSDRADDDVKLSSNLVILPSRDLQYVSATYDISRVEHAIVYHIYSTGRLSSYYYPFKLPIK
GDPVSLQIECFPWDRKLWCHHFCSVIDSGTGEQVTHIGVVGIEITCNGK

Molecule Role Protective antigen
Related Vaccines(s) v2RVFH
References