VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign2
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

RASSF4

Gene Name RASSF4
Sequence Strain (Species/Organism) Homo sapiens
NCBI Gene ID 83937
NCBI Protein GI 23510360
Genbank Accession AL353801
Protein Accession NP_114412
Taxonomy ID 9606
Chromosome No 10
Gene Starting Position 44959752
Gene Ending Position 44994723
Gene Strand (Orientation) +
Protein Name transcript variant X12
Protein pI 7.85
Protein Weight 35159.8
Protein Length 321
Protein Note Also known as AD037
DNA Sequence
>NC_000010.11:44959752-44994723 Homo sapiens chromosome 10, GRCh38.p12 Primary Assembly
CGGGCCTGGCCCCGAGCAGCTGAAGCCTGGGGTCAGCAGGCGCTGCGGGCGCAGCTCCGGTGCAAGCGAG
GACACGACACATGCAGTGGCTTCTGGACTGCGCGATGACTGGACGGTGAGTGATGAACGAGCAGGAGAGT
GCTTGGGCGTCCATGGAGCATCCCCTCCGACCCAGGACTGCCACCAGGCAGGGACGCTGAAGCCTGGGCA
CTTGTGCCCTTCGGCCGCAGCGCGCAGGGTCCCTCCCCCGCCAGCCTGGCGCATTGCGGGCCTCGGGCTC
ATTGCTGAGAGGGGGCACTGCGCCTGGCACCTCTGTTAAGCAATTTAGGGGCTACAACCTGAGCAAGACA
GATGAGCCCGGCCACTGGCTACACCTTTTTTGTTCACCTTGTCCTTAACCAGTTTCCTAGAAGCACTGAT
CCTAGAGTTGGGGAGAGAGCCTAGAGGCCTCTGGCACAACTCTGATTTCACTGATGGAAATCGAACGCCA
AGATAATAGCAGCAGGGGGGGTCTGTCTCACAATCGCTGTCTGTAGAGGGCTCGCCTTGCTCTGGGCCAA
GTGCTTTAACACGATATGCCTCTTACTCCTCACAGCAAGTGAGAGTCCTACTTTCGTTATCCCCTTTTCA
GATGTGAAAACTGAGGCTTAAAGAGTTATAAAATTGTCCACCTTTACCGGATGAGTTGGTGATGGAGCCA
GGATTTGAACCCAGGGCTTGTTGTGCCCCTGAGTCTCTTGCTCTTCACCCTTAGTCTCCGAAGGTCAGCC
TGCCTGCTGCCCTGCTCTTCTGGGCTCCTGACTCCGGTCCCATCCTGCACTTCCCACTTCCAAAACATGC
CTCAGTGTTTTCATTAACCTGGCACGGCGGAGGGAGGGAGGCCTCCTCTCACACCAGAATCAGTGCCCAG
GCCAGGGCCAGCACTTTCTTAAAACACAGTAAGGACAGCTTCAGGAGCCCCATTTCACATAGGAATTAAA
TAAGGTCGCACAGCAAATAAGGGCTGGGCTTCTGGAATTTGAACCCAAGCAGGTTAGACTCCAAAGCTAT
GCTTTGCACTCACAGAGGAGCCCCTCGCTGGCTTTGCTGTAGTTTAACTGCCCACAGTACTAAGGTGTCA
ATCAGGATTTGTTGCCAGAAACCATTTTTTTTTAAGTTAGAAGTGAATTGGTGAAGTAACAGGTAAATGT
AGACCATCCTGCCTTCTGTTCCTCTGTGTGGTTCCTTAGCTACTTCTGCCAGGACAGCAGGTTAGGGGAG
AAGACAGGAAGGGAGAGGGTCAGAGGAGAAAGAGGAAGGGAGGGAAGAGGAGAGATGAAACTCATTAAAC
TTAGGTTAAAAAAATGCTGGCCGGAAATTGTCATGGGCTGTTTCAGCACTTTGTCAGTGTATGTGAAGGC
TGTTGTCATTAGTTCTAGCCATAATTCTCTCAGTGTGTAGTGCTGGTGATTTGACAACAAAAAGGTTGAT
GCTACAGATTAAAGTGTCTGTCTGAAACTCAGGAGATTGGGTTGTATTTCCACCATGAAGCTCCAGTGGG
TAGCCTGGAGGTCGAGAACAGAATCAAGGTCCAGGGTCGCCCTGGGTCAGGACCAAGTGGACCATGACAG
ATAACAAAGAACATGAACGAAACTTGGGTGTGTGTCAGAGTTCAGATTCTGGACGTGCAAAGCCTCAAAG
GGGAGACCTAACTAGGGGATCTGCCAGAAAGCCCTCTGCCCTGGGCCCCTGGGGTCTGGGGCCTGGTTTC
AGGTGTCAGCTCAGACTCTCTCCTCATTCATGGCCACTCCTGCAGGCAGGCCTCACATTCCCATCTCTGG
GGCTCCACAGTCTCTCCAGAGCCCCCAACTCCCAGTGTCAATAAGAATAGTAATGGGAGCCTCTTTTCAT
TATGGGTGAGCCCAACACAAGGCCCATCTTACAGGTCTCCTCATTCGTCTTCACAGAAGTCATCGAGGAT
TATAGTTATTTAATTGATGAGGAGCCCAAGGTTCAGAGAGGGAACTGGACTTGCTTAAGGTAACAGAGCC
AGGCAGTCACAGAGCAGAGCTTTAAACCCAGAGCCTTGCAAAGGCTAGGTGGTTATTCTCTCACAGAGTA
TGTTTGGGGAAATTGTTTTAAAATAAAGAAAATCAAATAAGAAGTGGCTGCACTTCCTAAAGCTTCAACA
GTTTTCTTATTTTTGTAAAAGAGAAACTTGTAGTTCCCGGGGTCTCCTTTTCTGGCTGTCCCACCTTCTG
CCCTAGGATATACTGTTGAGGAAGAGGCCCGGAACCCCCTCCCTTTGCCCTGCCTGACCTTGGGAAGCAG
GGGTGGGGTGTCATTGAGCCCCATAGCTGCAGTGCTGGGAAGAGCCCTGAAGACTCTCTATCAGCTGCCA
CAACAGCTCTGGCTAAACTGATGCCCAAGAGACGGCGCAACACGCTAGGATCACAGGCCAAGTTAATGCC
ACAGCAAAACTCACATGCAAGGCTCTACAACGTTCCTCTGCCTCCTCTTTCTTGCTGTGACAGGTTTCAG
CAGAGATTCTAAACCTAAGATCTGGGGATCTGGGAGTACATGGACAAGAGCTGTCTCATCTCCCTGCAGT
GATATGCAAATTGTGTGTGTGTTTGCACGTGGATGCAGATTGCAACAACATGCACATACATGCATTTTCT
GGGGAGAGTGCACTAAGCTTTCAAGAGACTCCAAAGGACTCTATGACCCAAAAGATTCTGGGACCCTTTT
GTCTCACAGGGCCCTTATGTCCCCAGCAGTGACATGTGGCACACAGGCCTGGGGCAGTGGACAGCACAGG
TGAGGGCAGCCGTAGAGAGCCTCCAGAGCAGCCCTGCAGCAGCAGGCACCCAGAGGGGTCTGCCCCTCTG
CATTGCACTCCCAGCCCCAGGCAATCGGGATATTGGACAGTGCCCATTTTGAGCACGTTTGGCCCGAAAA
CCATAGCTAAGAAGATCTTTGTTTCTGTGGATCTTCTCTTCCATAGGCTAGAGGTGAGCCTGGTTGGTGG
GGAAGTTGAGGAGTGGTTCAGGGGGTTCCAGGAGCAGAGAATGTATGTTTAAGGTGTAAGGGGGGAGCAG
GAGGACTGGAAATGGTTTTCTTGTCCCAAATTGCTTTGCCTTGAAACAAGGGCAGAAGCCAGAAGTCTTG
CCCACTGGGAAGGCTGGTCTGCGATCTACATGGCTGCTCAGGGCCAGGCTCTCAGAGGAAGGGGAGCTGT
ATCAGGGAGGCCTGGATGCTGGACTGGACTCAGAGAGACCTGTCAGTGAGAGGCCAGAACCGCAGCGGGG
AGTAAAGGTGAGCTGGGCCTGTGTGGTCAGTCCAGGGCAAGGCGGGAGTGGAGGTGGAGGGGAGCTCTGT
GCCCGCCTCTCCTGGACTCCCCTGGTCTCCATCACCTCCACCTGGACAGTGCAGAGTCTTCTGGGGCAGG
GAGGAGTGAGTTGAGCCAGAGGGATGATGGCGGGAGTGGAGAGGAGGGGTCTGGTGATTGGAACTGGGCA
GCAGGAGGGGACAGCAGTGTGGAAGGAGGTGGGAGCAGCAGCTGCTGAGTCGCCGCCTGCCATCTACAAC
CAGACAGCCGGCTCTCACCACAAAAATGCTTGGCTGAGGGTACCCCCTCAGAGGCACCTGGTTTCGGCAG
ACGCTGCAACTTCTTCACTGGCCAGGCTCCTGCCATTTGCTGGCGAACAGGTGCTGGGAGGGGCCTTTTA
AAGCTTCATTGTCCTCTGTGCCCTGCTGCCGTTGTGGCTGGCAATTCGAATGTGGTAGCCACAGACTGCA
GTCAGGAACTTAGTCCCCCCAGGAATGCCGTCAGCGTGGCCTGCACCTGCTCTGTGGCCTGCACTTGCTG
TCCTCCACCAGCGGGAGCAGCTCAGGCTCCCAGCTGTGCCCCACACACTTGTCCTCCTTTCTTTTGCTTC
CCAGGTCACTTTCGTTATGACCTATTTGATTTAAATCACGCTGAAATAAGAAAATAAAAATCACAATTTC
AGGAAATGTGAAAACAGAGGTAACCAAGCTCTCAGACTTCACAGATATGCTTAGAACATTTTAATTTGGA
TGCCTGTACGTTTTCCCTTTTGCCAAGTGAGGACACCACATCTGTGTTGGCCATGTTTTATGTAAGAAGG
GACACTGTCAGAAGGAAAAGCAGGCAGCACAGTCTTAAAATAAAAGGCTTTCAAGTGGACTCAATTTCGT
GTCACGAAAGCCTCACTTCACTCGGCATCTTCTGTTCCTTTTGCCACTGGCCTGTAGGAATTGGGCCCCG
GGGGTGACTGAAAGAATCACAGTCACCTTCTTCTGTAATAACTTTCCCCACAAACACAAAAAAGGAAAGA
CGGCCCATGCCTAGCAGCTCTAAAGCCCTCGGCGGCCTTTGTCCCTCAGTAGTGACAGCAGACTGTCTCT
CTCTGCACGGCTGGCAGAGCAGCTGCTGAAGTGGAAAGGGAGAACAACTCACTGCTTGTTCACTGGGACA
GGTAGCCATGGCTGGCATGCCGCCTAGGGGGCCTCCTCTGGGGTACAGACAGCCCTGGCTGCAGCTGATC
ACTCTGGTTGGGGACAGAGTGTCCTCCAGCCTGGGAAACAGGCGTGGAGGCCTGAGCTATGTCCTGGGAC
CTGGGGGAGGGGAACGGGCCCAGACAAAGAAAGCTGTACTTTCCCAGCAGAATGGCACGGCTTGGAGGAG
GGGAGAGCCTGCTGGCCGACTTGGCCTGTCCAGCTGCATCTGTCACTCTGTGGTTTTTTGAGCCTGAGCC
TGGGTGGCAGGCCAGCCCCAGCCCATCCTCTCCTGACTCCTGCTGCCACCCATGCAGCCTCGCTTTAATC
CATTTGTGTATTGGGCTTCTACCTAGGATCTAATTTCAAGATAAGGTTGTGCTGTTTATAAAAGACTGAA
AAATACTCCAGCAGAGATTCTCAAAGGCCCCACCCAGTGCACTTGGAGATTCAATGCAAAAGGCTGTTCC
AGGAAAATGCTCCAAATAGAGAGATGGCTCCCTTTCCTCTCCTGTTGGGTGTGCGTGTTCCCCCTTGCAG
TTTGCTGCTGCCACAGCTGTCTTTCAGACACCCCTTAGGTACTCATGCAGTTTCCTGTAGATGTGATGTC
AAAACGATTAAATTCATCAAAATGAATGAAAGTCTGGTAAAGGGGATAGGGCGCAAGCACAGTGTTGAGA
TCTGCAGTGGAATTCTGTGAGTGATCCTGGAGCTCAGGAAAAACAGGTCTTCTTGCGGTGTTGGCTCTGA
GAACCAGAGAGACCAAGTGACTTTTGTGGGAGCCATAGGCTCTTGGCCCCTTAAAGTTTCACTAAAAATC
ACAGACATGAGGCAGATTGATTAATAGGAGAAAAGTCATACACATGTACTTAAGGTGCATGCATGGGAGC
CTTCAGAATGATGGTCCAGCTTCCCAGTGAGTAACAGAGACTTATATACCATTTTGAGGTTACAGAAAGA
ATGGGGCTTAGATTCTGGTGAAACAGGCTATGGAAGGAGGAGAGGCTTGGCTAGTGAAAGTGACCTTGTT
ATGTAGATGAAGCCTCCCTCAAAGAGACTTTTAAAGGTGTGGATTCTCAGTCTCTCCTGGATGTGGGGAA
AGATCTGGAAAGGGGAGGGGGCCTGGCTGCATTAATGGAGATTCTCTACAGATGCAAATTTTCCCACTGA
AGACACTCTGCTAGCCACTTCTTTCAGGATGGGCAAGTGGCAGCCATTTAAGAATACGTCAAAGAAATAT
ATGTTGGGGATAAAATATTTTCATCTCCTTCCCTTGCTTAGGGCCATGAAGCTAATGAGTGCTGGAGGAC
ACAGAAATGTGTGCCTCTCTCAAAGGAGAGACTCTCTTTGTGTGGAGCCAAGGTTCCCACCCTGTAAGGC
TCAGGACCCAGCCCAGCAAGCTGGAAAAACCTCCTTTTGCTGCAGTGGGCCCTGAGCCACCTCCCTTAGC
TTTGCTCGCTGACCCCCCTGCCCTCCCCTGGGATGGTGTGCCCCGTTCTCTGCCCCAGCTGTTTACCCTA
CAAGCCCACCTTGCCCTTTATCCCTTCACTTTGCCATCTGCAGCCTAGGACTCTCCTTTACTTTCCTCCT
GGTCTGTCTCCTCTGAGCAGGTGCCCCCAGCTGGTGCCATTCAGTCATGGCCGGAGACACTCAACACGTT
GGTTGTGTCCTATAAATAAGCAGGCGTGCAGGGGAAAAGCACTCCTGAAGGCCAGTGAGGGAGAACCATG
CTTTTCAAGTAGTATTACCCAGAGCTCTAGAAGATGAGGCTCTCTGCCACCACCACCTCACTGTCAACCA
CGGCAATCCCCTTTAATCTGTTTTGCATACATTTTCTATTTGAACAAAGAGTTCCACAGTTAAGAAAATT
TCAAACCCATTGGAGGTCAATATTCTTGTTGTACAGATGGGAAAATTAAGGCCCAGAGAGGAGAAGGCAT
GCAACGAAGCACCCCAGAGCTCTTTAGGAAGCATTTTCTATGAATAAGTAACCACTGCCTGACTTATGGG
AAATTCCACTTCTAAGTGTTCCTACTACATATGGCAAAATGAACTTCTTCCCCACACACTATAGGAGACC
GGAAGTAAATGTAAATCATGCCGTGTCGTGAATCAGAAGTCACAAACTGGAGCCTCACTGTCCAGTGGAC
TAGGAGAGGTCCCCAAACACTGGTGGGACTTCGACCCCAGCTGATGTCCAGGCTCTTGACTCCTTGAATT
CCTTCCCATATGAGTCAGAAAATAGTGAAAGTACACACTCAAGAAGGGAGAGTGTGCAAGGGGGTTGGGA
GCTGCTTCCTTTATGGGTTTCTTTAACCAAGGGGTGCAATATCCAAGAAGATTCCTGGAAAAAGGTGGAA
CTTTCTTGAAACTGTGGTGCCACCCATTTTTACATGAAATATGGGTGTTCTGGAACTGTCATGGTGCCTG
TGGGTGTGTAATTTAGCATCTCAGAGAGTTGCCTGGTTAATGAGCGTATAGTGAGGTCCTAGAAGAAACC
TAGGTCGAATCCAGCACCACGTTGGTTTCAGTTGGTCTTAGCCAGCTTGGCCCACACTCTGATTTTTTTA
GAGTCTTATGACCCCTAGCTTCTTATGACCCTTATTTTAACAGTTTCCTTTTGCTGGTCATGTGAAATGG
CTGCCTAGAATTTTCTATTCTCCTGTGACCATCTGTATTATTCCTGTCTCACCACTAGGTGTATCTGTCT
TGCAAAGATGTTTAGTTTATTTATAAACATATTTAAATACAAAATATTACATTAAATATTTGTTGTTTTG
ATTGGATTATGTATTGCATGAGACTTGGTCTGGGTTATGCTGCAGTAACAAATCCCTGATACACCAGTGG
CTTGTCACGGCAGAGGTTTATTTCTCCCTCTCAGTCCATATCCAGTGTGGGTTGGCAGACAGTTCTGGTC
CACAGTCACTCAGGGACCCAGGCTGACCATCGAGTAGCTGCACATGGCTTGAAACACATGGCTTTCTGGG
TCACCACGGTGGAGACAGGAGAACTGGAGGGTTGTGCACTGGCTCTTAAAGCTGCTGGCCTGGAAGGGAC
CCACAACACTTTTGTTCGCAGCTCAGTGGTCAGAATGAGGCCCACAGCCCCAGCTAGCTGCAGAGGGCCG
GGGTGGTGAGCGACCACACGGGCATTCCAGGGACAGTGCATGCCTCTGCCAGCCAGCCACCTTTCAGTAG
TGAAATATAGCCCAGAAAAATCCAGATTCCTGGCTTCTTATGAAACGCCAAAAGAGTTGCCCCGTCGAAG
AAGGAATGTGCCCCCCATTCCCCATGGACCCCGTGACGAATGTCCCTCAGCGGAGTCACCTCCGTGGCCA
TTGGAGACTTTTATATTATTTATTCCTGCTGTATGTGCACAGCTTTGGAAGAGTAGACTTGGAGGGAGTC
TAGAAGCTTCTTGTATTTATTCAGCAATTTAACAACCATGTATGGACTTCCTGCGATGTGCCAGGCTTAT
GCTTGGGGCTGGAAACTAGTGGTAAAGCACCCCCCGCCCTCACCCCCACCATGTTCCCGTTCTCTTGGGA
GGGAAGTCTAAACAAGAGCTGGGTTCTGCAGGGCCCAGTGGGGAAATGGGAAGAGACGATGGGGCAGAGA
GGGGCTGCCCCAACATGGACTGGGGCTTTTCTGGCAAGGGTTTCCAGGAGGAGCTAACATCAGAAGACAG
GAGTAGTTCTGGGTTCTGAACAGAGAACAGCACTACAAAAGCCCTAAGGGAAAAAAAGCATAGGGCTCCT
TAGGGGAGCCGTGAACTTGCTCAGTGAGCCCAGGGCTTAGAGCAGGAAGTTGGGGTGGAAGCTGGATACA
GAGGAAGGCAAGAGAAAAAAACACTGCCTGTAATTTTGGGGTAAATCCAGCCCTTCCTGTAATGAGTTTG
CTGAAAGCAAGACTTCGTTATGCTGAAGACCCACAGAAGCAGTGTGGGCTAAGAAACCCAGTTCCATGGC
TCACCCTGGGCTGCACTAGGCTTCTGCCTTGCAAGTATATGAGGAACTACCCAGAGAGGGGGGCAGATCA
CTTTTTCCATGGGCAAGCGGAGGTGCCGAGGAACTGAAACTTTATGTTGAAATCCCTGTTGCCTGGCCAA
GAAAAATGCAGCAATAAGTCCCCAGCTCCAGGCCTTGCTGCTGGGGGCCTGACATCTCTCCAGGCCCTGA
GGTGCCTAACTCTGGAGCAAGGCAGAGGGGAGGTATGGATAGGATGATCCTGAGGTCATCAGGAAGCCCA
CTCCCTCAAATCCTTCCCCTTCTCCAGGCCAACTGTATTTCCCTGCCTCTTGCATCACAGGCTCATGCAG
GGCTGATGCTAGCACAGAGGGCAGGTTTGTCACATTTGTGGGTGTCAAGCAAGGGGGGAGAGAGCAAACT
GGACTGGTCCAAGTGAGTGCCTGAGGAGCTGGGCATTCTGCAGGGATGGGCTCTGAGGACATTAATAAAT
ACGACAGCAGGTGGAGCTGAGCTTGAGCCCCCCGCCCCCCGTGGCATTTGCACACACTCAGGTCGGGAAG
ACATGATGGGTTTGTGTGAACAGATGTGGGGGAGTTGTGAATGAGCAGAGCTCTGTCGTGGGCAGGATGT
GGTGTGGCCCCAGGCTGTGCCCCCTCCCAATGTGTCCTAACACCCCTAGCCCTGAGCTGCAACTTGGGAG
ATGGAAGGTGGAGGCAAGGTCAGCACTGGAGTATGTGTGTGTGTGAGTGTGTGTCTGTGAGATTGTGAGT
GTTTGTGTATGTGTGTGTGTGTGTGCATGTGAGCATGTGTGTATGTGTTAAGTGTGAGTGTGTGTGTTGA
GTGTGAATGTATGTGTGTGTGCATGTGATTGTGTATGCGTGTGTTTTTGTGTGTGTGTGTGTGTGTGTAT
GTATGTGTGTGTGAAGCTTTACCTCCCTGCCTAGCATGTAGGAGGCCTTGATAAGAGTCCTTGGCCACAT
TGACATGGGGGAGAGAGAGGAACAGGAAGCTGTGCAGATGCCAACAGGTTCGAGAAAGCTCTGGTGGATT
TACTGTCCGTGAAAGAAACCTGGGGAGGGCAGGAGCGGCTCCTCAAACCAATCAAGGCTGTGTGTGGAAA
GAGGGAATAGTATGTGTGTGGAACAGTGTGTGTGAACCGCGTGTGTGTGGATCCACTAATGATCCTGTGG
GCTTGAGATTACCTTGTTGCACAGACGAGGAAAGGAAGGTTTGGGAGTTTAAGTCACTGCCCGTGATCAA
TATAGAGAAGGTACTAAGAGACCAGAATCAGGGGTCCAAATGCTTGTGCTGGAACAGTGGCTTTTCTGCT
TACTTGCTGGTAATCTTGGGCAAAGTGCTTAAGCTCTTGTCCCTGTCTTCTCATCTGTAAAATGGGAATA
TGGTGATACTCACCTCACAATATCGTTGTAGGGACTGGAGGAGATAACTCAGAGAAGATGCCAACCATTT
ACAGCACATAGGGAACACAGTGCCGACTAACCCACTGCCAGGACAGCCAGTGATGGGCCACTGCCTGGCT
GAGCGGGAAGGCAGGAGAGAGGCCCAGGGTAGCTCTGGAGGATTGCAGGAGCAACCGAGGCAGAAGCCAG
TAGTCAGGCTGTCCCTGCCAAGGGAAGGGAGCATGTGATCTAAAATGCTTAGGAGATGGATCTGGATTCC
TGGGGATTATGGAGAGTCTTCTGGGGTGGGCGGCTGAAAGGACCAGTGTCACTGGCTCAGCATGACCTTG
CCCAACCAAGGCAGCTTGACTGACATGTGGCCATGTGGGTCTGGGCCAGACCCTTTCAGCCGCAGCCACC
TTGTGCCAAGGCGGTGTGATGCCAAGGCCGACGGTGTCTGTGCCAGGGCTGCGGGTGTTGGGTGCTGCAC
TGGCCGGCACTCCTCTGGCTCACCTGTCTGTCCACCCTTCCTTGTCTTCCCAGCAAGTAACTTCTAGGTC
TGCAGACAAGAGGAAGAGAAGATGAAGGAAGACTGTCTGCCGAGTTCTCACGTGCCCATCAGTGACAGCA
AGTCCATTCAGAAGTAAGCCTTGGTGTGCAGGTTGGGCGGGGGAGTCTTCACATTTGCCATCCCCCTCAT
CCTGGGCAGCCTTTAGGTGGAGGGGTTCTGAGCACTTGTTCAGAGATCTGATGGGGTGCCCTGGGGGACA
GTGATGGGGTGCTTCTTTTTGAGCCTGTCCAATAGGGGATCCCCAAGCTACACATGACCATGGCTGGGAG
GCATGGGCAATAGAAAAGAGGCTCCAGATGGCAGGCACTTTATACGAAATAGGTGTGTACAGGGCCTCAT
TATAACTTTTACATTGATTGCATGTTGACAAATAGTAATTTAGATATATTGAGTTCAATAAAATGTGTTA
TTAATGCTAATTTCACCTGTTTCATTTTCCCCTCTGTATTAGGCCATTCTTGTGTTGCTATAAAGAAATA
CCTGAAGCTGGGTAATTTACAAAGAAAAGAGATTTAGTTGGCTCACGGTTCTGGAGGCTTTACAAGAAGT
GTGGTGCTGGCATCTGCTCGGCTTCCAGGGAGGCCTCAAGGAGCCTCCAGTCATGTTGGAAGGCGAACGG
GGAGCAGGCACTTCACATGGCGAAAGCAGGAGCAAGAGAGAGGGAGTGGAGGGTGGTGCCACACACTTTT
AAATGACCAGACCTCGTGTGAACTCAGAGCAAAAGCTCACTTATCACCACGGGGATGGCCCAAGCCACTC
ATGAGGGATCTGCTCCCATGATCCAAACACCTCCCACCTGGCCCCACCTCCAACACTGGGAATTACAATT
CCACATGAGATTTGGGTGGGGACACACATCCAAACCATATCACCTCCTAACATGTACTAGAAGATTGAAA
TTACCAGTGTGGCTCACATCCCACGTCTGCTGGCCCCACAGCCCCACAGAGCCCAGCTTGGGTTCAGGCA
GCTGTCCAGGCCTCCCCTTCCTCCAACATTAGCCAGGGCTGTGGCTTTCCCTTCGGGAAGGGAGACAGCG
TTGAGGGAAAGTGGCTTACTGCAGACTTCAGGGCCTTACTCACAGGGCCATCACCTTCCACTGCGCCTTT
GGAAAGTCAGGGTGGGGAAGAAGCAGGCACCCCTCAGGGTGGCCCGCAGCAGCCACAGCAGGCCTTGTAG
GAAGTGATATGGGGAAAAGCAAGAGGCTGTACAATGCCAAAAGCAAGTCCAGGGCATTTACTGTGAGGAA
GCAACGCAGGTGGAGGGCAGGGAGGCTGCCAGGGCCTTACCTGTGATAGTGAAAGTGTCGGCACCCTGGA
CATCCTGGACCAGACGCAGGCCTGTCCCGTGAGTCTCGCCTCCTCCTCAGCCCGACCCCCATGCCCCCCA
CCAGGGCCATGTGCAGAACCATCCGGGTGCATTGCGATGGCAGTCTGGTCTCCTCTGGTTATGCCTGGCC
GGCGAGAAGGGTGCTGTCACACTCCTGTTACAAATGAGGAAACAGAGGCCAGGGAAGCCAAAGGCCAGAA
GCTGAGGCCCTGCCACACCCTAGGAGTACATGTGTGTCTTTCCCTTTTTAGGTCGGAGCTCTTAGGCCTG
CTGAAAACCTACAACTGCTACCATGAGGGCAAGAGCTTCCAGCTGAGACACCGTGAGGTGAGCCTGTTGC
TCTTGTTCATGGGGTCACCATGTACCCTGGGAGGCCCTGCCTGATACCTGTTGTTTCAGGGTAATGATGA
AGACCATCCCCTTCACTCTCAGCAGTGACCTAGTTTGGACAATAAGTTATATGGTCACTCTCATCACTCA
CCTCTGACCCTGAGCCAGGGACCAGGTTACCAGCAGCCAGGTCATCTCCCTTGCAGAGGGTCAGTGCATC
CCTTCCAGAGTTCCCAGTGGCAGAAATCACCTTGGGGGTCTTCCCCCTTTCCCCTTCCCCCGAGACCTTT
GTCCATGTGAACTGCTGCCGAGAACAGGTCCGTCCTCAGCCCATCACACCATTCAGCGGACAAGAGGAGT
CAGTCCCTCTCTGTTCCCTGCTGGTCCCGCCACATATCTGCAGGGTCTCACCTGTGGCCCCTGGTCCCCA
GTACTCTCATTTGTAAAGTGGGGTGTGGGGCTACACAGGGGCTTATAGGCTCAGATGCTCACAGCAGGCA
GCGCAGGTGTGGGGAGTGGGTCTCCACTCAAGGAGTCAGCCGCCCATCAGATCAAACCATCCCTACTGTG
CAGGACCGTGGGCCTGGTGCAGCCAGACCCTTTCTGATTTTTCAGAAGAGGATAGATTATCTGGAATTTC
ATGAGGAATTTCCCAAATCTTGAAACATCATGTGGGCTAAATACATGTCTGATGCCAAACACAGCCCTTG
GGCACTGGCTGGACTCTGCAGGGCCTAGGCTTGGGGGACCACCCACTGGGCAGGGCAAGTGGAGCCCTAG
TCTTGCGGTCATTCACATCCTCTGATGTTTCATGCGGGAATCTTGGTTGGGCTTTGTGGCCCTATCTTGG
TCTAATTCAACATATTTGTACCGCCTAATGGCAAGTCTTATCGTGGTGAGGCTGTTTTTTGGGGGGTTCT
GCAGTTGAGATTGGGTTGGCTCCCGGACTTTCTCTCCTCACTAGTCTTGGCTCACTAGTCCTAGTCCTCC
CTCTTCAGTAACTCAGACACCCTTCTATAGCTCCCAGGCCAGAGCTAGCCCAGGCATCCAGGCAACTCTG
GGCAGCTGGGGATTGCCAGACAGTGGCAGATCAGAGGGCCGGCTGGAACCTGCTGCCAGACGGCCTCAGC
CAGCCCCTGAGGCGTCCCCTCGGCTGGCCAGGCCAGACATCACACCCTTCAGGAGCTTCTGGCTCCTGGT
CCAAGCTGTGCTGGGCTGCCTGTGACCACCAGGCATGGTACAAACCTCACACTCTGCCTCCTTGACCTGC
CCAGGCTGCGAGGCCCCACAGCTTGCTCCCCTCCCTCTCCTGCCATCCCACCTCCTCATGCTCACTTCTG
TGACACCTGTCTCACCCTGCCTGCCCCCATCCTGCACTCCCCAGGCCGGGCACCCTGTGGGTCCCTGTGC
AGAGTTGGTGGGTGACTTAAGCAGCAGGTGTAGGCCTGGAGAGAGTTGGGGTGAGTCCTCGGTCCTGAGC
TCCAGTGTGCTGGGTAGAGGGAGGCATTGGGGAGAGGGTGATGGCACCACAGGGATTTCCACCTGTGCTG
TTAACACACGCCACTTCATATCTTCTGGTGGAGGCCTGGGGTGTGGTCACTGCTGTTCTTCAGCTCTGGC
TGTTCAGGGATTGATCTAAATCCCAGGTGGCTTTCCACAGGTGGTCCAAGCACCAGCTGCCCTGGGAACT
GGTTAGATATGCAAATTCCTACCACGCCCCTCTCCCAGCCTGCTGAACCGAAAACACTTAGTCTTCCCGT
CCAAGTTTTAAGGAGCCCTCCAGGGCATTCTGGTGGAAGGTCAAGTTTGAAAACCACTAGTAAGAGCTTA
GTTTTGGCACTCGGGATTCCCCAAGATAATCCCCTCTGTAGGAACAGTTGTCGGGGGCAGGGGCGCGGGA
GCGGGAAGCCCCAAGAGCCTCCACCCTGCGTTTGTGGTTTGTGTGTGTTGGTGTATGCTGCGGGACAGCC
CACATAGAGAAGTAGGGGACTCTCGGGCTGGGAAGAGGTGTTCTTGACAGCCCTTAATGATAGAAAGTTA
ACCCACTAGGGGGATTTTCCTGTCCCTAACGCTGAAGAAAGTGTAAGGGTTTGACCCGGTCTCCATGGAG
TCAGAAAGTACCTTTCAGGAAAATTCTGTAGCCTTAACAGCCCAGGGTACCGGTACCGGCCTGAAGAAGT
GTGTGTTTTTGCTGGGTCGCAATTACCACATAAGACGAGGCTTTAGGCTGTGACACTGATAGGCACAACT
GGTCCCTGGGGCACCAAGCCCCTCCAGGTCTCACTGCCACCCTGTGATGCACCCACCACGACCTCCTGGG
CCACTGGGCACTTGCTGCAGGGGCAGGGCCATCCCAGGCCAGTCTCTCCTCAGGCACCACAGGCCCCAAG
GGCTGGGCAGACAAGAGGAACAGACACTTCCCCAGAGAACCTCCAATGCACCAGGCACTTTGCCTCTCCT
TTGTTTAATATAAGGTGATATAGGAATGATTATTTTCCAGGCAAAGAGATGGAGGCTCCCAGAGTTTAAG
TCTCTAGTCCAAGGTCACATTGCAGTAAATGAAAGGTGCTGGCCATGGCCCCAAGCTCACAGCCACTTAC
AAAACAGCAATACCGTTTCCATTAGGCTTTGGAGGTCTCCACCCAGTATCAGTGAACAGGTCTCAGGGAC
ACAGGGTGCTGTTTGTTGCCCTTGAGCCCCAAGCTAAGGGGCTCTCAGGCTGGCGAAGGGCTCACCACCC
GGGGCGCGCTCCCAGAGCCGCCTGAAAGAGACCCCCCCGTGTTGTCACTGCCCCTCACCCGCAGCACCGG
CAGCCTTAGCAGTACGGTTTGGGGTGCCTTCTCCTCCACTGTCTCATCCCACTTCTCCGAAGGTGGGCAG
GGCCACGCTCTGGGGCCAGCGTCACGCCCTGGGACCAGCGGCTCCTTGTGAGCCTTCTCCCCGCTTCCGA
GGGGCTAGAGGAGGGACGCCATCTCTGGAGGCTGAGGCGCCGACTTCCTGTATCATGAACCTCGCCTTTG
GGATAATTTTGCTTGTATTACAACAAAAAGCCTGAGCAACGGGGAACAATCTGTGCCTTTTGAAGATGGC
AAAGGGCTTTAGCCAGGCTGGCTGGTATCTCAAAAGAAAAAAGGACCGCCCGGAAATGTCCTTGTGTAAA
CCCATGGCTCTGGACAAGCAAGTGAGCCCCAGGCGGCAGGACCTTTTCTGGGGACTGTGTGCCGGCCCCG
CCCGCCTGGGGCGCGGCGCCGAGGCTCCGGGGCGCCCCCTGGTGACCGCGGGCGCGCTCCACATCCAGTC
CCGCTCCTCGGCCCAGGGACCCCTCAGCAATGAGAGAAACGGAAGGGGCTTCCCCTGGTCCGGGGGCTCC
GTCTCTCCCAGGGGTGCGGAAAACCAGCATCCCGCCTTGAGAGAGTTGCCCCGTCCCCTCTCCGAAGGCC
TGGCAGACCACTGGCCCCTGGAGTGACTGGCCAGCCCCACGAACATCTGTTTTCTGGGAGCCGCAAAGCG
CTTCCCAGCCTGCCCGCTCTGGGCAGTGCCTTGTGTCCCACTCACTCCCTTCTTCGCCTCCCATCCCCAC
CTTCCACCCCCACCCCCACTCCCCTCTCCACCTCCCACCCCCACCCCCACTTCCCTCTCCATTCCCTTCT
CCAGTCCCCTCTCCACCCCCAGCCCCACTCCCCTCTCCATTCCCACCCCCACCTCCACTCCCCTCTCTAC
CTCCCTTTCCACTCTCCCCACCCCCACCCCAGTGGCAAGAAGGAAGGAGAATGTAACTGCTCTACAAGGG
CCCCACCAGGAGGCTTAGCTTGAAGGGAAAGGAATTCCCCTGGGCCTCTCTGCAGGAGCTTGGGACACTG
CCAGAAGCCCCAACCACAAACCTGTATTCTACTGGGAGGGAGCGCCTTCCAAAGGTGCCATTGACCTCTT
TCACACAGCTGGGTATTAGTGAGGAAGCCCGGGGATGGTCTCCTCAAACTGCCAGACCTCCCCAGATGCA
GCGAGGTGGCTTCTGAGCATAGGGGAGTCTGCTGACCTCATCCTAGTTGCCGGACTCTCCCTCTGACCCC
GTTTCATGATGCTTTGCAGAAGGGGCTGTAGTGAGGCTGGGCCCAGCAAGCCCGGACCTCAACCCCTCTG
CCTTGGTGGGTGGGCCCTCTGGATCTCTCCCGAGGATGATGATTGGCTAAAGGCTGCCCCGGCTAAAGGC
TGCCCCACACGTTTGCCCAAAGTCAGGGACCTGCAGGTTTGAGACCACCACAGAGACACAGTGGGCTGTG
ACAGATACAAACATTTGTCTACAGTGCTCATAAATGCAGCTCCAAGTTCACATGCGCAGATTCCCAGCCC
TTGCAGGGTGTGAAGAACATTGCTGATGTCCCCATTTTATAGATAAGGAAACTGGGTAATTGCTTGTCTG
AAACTTTTTCCTTTTAATATGGTTTACATTCTATCTCCAGAGAAAACACACTTAACAGAAGACAGAAAAC
ATTTAACAAATCCAAAGCAATTAAAAATAGCCACAAAAAAAGAGAATAACCTAGACTGACAGCTCACAGA
GCAAGGAGGTGGCAGAGACCTGCCCAGGTGAGCTTGGCTGTTGCCCCCAGCTCAATCTTCCTCCTCTCCT
CTCTCTGTCCCTTCACCTCTGATCAGTCCCAGCCTGATTCCCGTTCCCTGATGCCTCACCTTCTTGCTGC
CAGATGCCTCTAGGAACTAGGGTCCTTCAGACTCCAGATGCCCTGACCTGGGCCTTAGGACATCTTGACT
TCCCCAGTGGACAGCTGGACAGTGCCCTGCTCTCACCCACAGCTGGGACCCTGACCATGCCATGAGGCCC
CTGTGTGGAAGTGGTGTAGGGGTGGGGATGGTAGCACTGAGTGGTACAGATTCTATCTTGGCCCTCATCA
TGGGGGAACTCTCCCAATGCCACCACAGGACGTATGAGTTGTAGCCAGCAGAGTGCCCCAGTGGTGCCAG
GTGACAGTCCCCCGGAATACATTAGTGCATTTGCTAAGACTCCATGTGTTCTCTTGGGCCTCACAGAACA
TGGGCTTTGAGGGTGGGAGCCAAGAGGCAGACTTGGGAGTGCCCGAGGCCTTGTTCTGAAACACCTGGGG
GGCTGACACCCCCACTACCCTCACACCCCTACCACCAGTTTCCCCACCAGCGATGATGGTAGCTACTCAG
CCAGTGGGCTCCTATATGCGGTTACACGTCAGAATGGCCTGGGAGGCAGGTGCCAGTAATTATCCCTATA
TTACCCATGAGAAACTGAGGAACACAGATGTTAAGTAAGTTGCTCAAGGTGATCAGCCAGCAAGGGTCAG
AGCGAACGGGATTGGTAACATCTCCTCATGTGAAACAGGCTGTTATCATATTCAGAGGGGGTCGGTCTCA
CTGTGAACTGCCCAAGCAGGGGCCTCTGCAGAAAAGCATTTCCCTTTCAGAGACCTGCCAGGGGCAGTGA
CCACCATGGAGGAGACGAGAGGAGATGCAGACCCAGCATGCTCTCTACAGAAGCCTTTACTGGGGAGGGG
TCAGAGTTCATGGATCACCGGGAGGTGCGAGTAGAGTGTTCTGAGGACACTGCTGGGGCGGGGGCGGTGG
CGGGAGGCCATGGCTTGGGCAGACTGCCCAAAAGTCCAGCTTCTTAGGTCAGAGCTCTGCTGCCCATCCT
GCGGTGGTCTTGCCAGGGAATGCCCAGGCATCCTGGCTTCACAGAGCCTCCCTCTGGGGGCCCCCATGGG
CTTGCTGCTGTCCATCTGTCTATGTGGACCCCAGAGGCCAGCAGAGGGGCCAGTCCTCCTTGGCAGGTCC
CTCTGGCTTGGCTGCTTTTCCTGGGACTCCCCAAAAAGCCAGTCCAGGGGGTCCACAGTATCAGCCATGG
GCAGTGTGGGCTGCTGGCCACTGAAACGTGCGGTGATGTCTCGCAGGGACACAGCAGGGCGGCCCTTCCG
GCAGGCCTGGGCTGGCCTGTGGGGTGGCCTGGGTTGGCCCTGGGCCGTGGCCTTGTCCAGCACAGAGGTG
GGCTGTGCCAGTCGAGATATAGACCTCACGTAGTCATCCAGGCTAGGAGAGGGTGGGGGCTCCTGTCCAG
GACCCCCAAGCAGCATCTCCTCCGTGGTCTCCCGAATTGTGGGCAGATGGGCCACGGAGAGCAGAAGCCG
GGACCTCATCACTCTGGCGAGAGGAGGTGGCAACCTGTTGGGAAACAGAAGCCTGGTGGTGAGGGCCTGC
CATGCGTCCCACCGCCCCTCAGCGTCACCACACTCCTCTGGGGCTGCCTGTAGGAATCCGGTGCCCTGAG
AGCAATTTGAAGTCTACAGAGCCCAGACCAGAGCTCCGACTGCTGGGATCTTTTCTTCCTGTTCAGGTTA
AAAACCCCAAAGGCTTAAGATTTTATCATTATCGTTTCAGAATGTGCACAGATAAGAGAACCTAACCTAA
CAAACACTGGTCAGAGGAAGGCTGGGTTTAAAACCAGGATCGGCCACGCACTGACCATGGGACCTTTGGC
AAGGCCACCTCTCCAGGCCTCCACTTACCCATCCATAAAACAGGGTTATAAATACCCCTGGCCGGGATGT
TGTAGGAAATGCATGAAATAACCCCTGAATCCCTTTATAAATGCAAAGCCCTCTACAGACAGCCCTGGTC
TCTAACCCATAGGGAGGCTGTGCAAGTTCAGGCTGGGAATTGCCCTCAAAAATAAACAAAGCCCTTGTGT
TTTGTCTCAAACCCAAGGGCAGCTGCTCTCTCTTACCTGGAGCTGAGGAGGTCTGGGGGTGGCAGGAGAA
TGGATGAGCAGGGACAGTCCAGTCCAAAGGAAGCCCCTGGGAAGCTTGGGGGCCGAAGGGTGGAGGGTCC
GGCAGGGGGTCCAGCGTGGGGTCGCTGGGAGGAGGACAGTGCACTGAGTCTCACAGTCCACCGTAGCAGG
CTCTTCCCTGAGCAGTGTGAAGAACCTTCGCAGGCAAGCTGCTTTTATACCTTCCCAGCAGCTATCAATC
ACTGTCACGAGGGCCAAAAATAGCCTGCTCGGAAGGCTGTCTTAGGAAAACAGCTTGGTGGGCGGGGCCT
GGCCCAGCTGCCAGCTTGGAGGTGTTTTTCTGCCTGTAGGAGGCTGGGGAATGTTTACGCTGCAGGGCAG
GAAAGGGGTGGGTTCACTGCTGGTCAAGTAGGGGCACTGGGAGAGGGAGGGGTTCCACTGGGCCCTCACA
GGTAGCCCCAGGGCCACCCCTGCCCCAAAGCTTGTTTCCCACTCTGTGTTACACCACCCCATCATGACTC
CTGTGAAGTTGGGCCAGGTCCTTGGCAACTTTGATGAAAAATCAGCAGCACAGGACCCCAGTCTGGAGGC
AGCTGAGGCTGGGTCCCTAGGCCTGCTCCTAGGAGAGACACACCCTGCTCGCAAGGGACCAAGGGCGGTC
TGCGGGGTCTGACCCTGGTCTTCTTACACCCCAGATGGGGTGCTTTCGGAGGATTTGTTTGTTTACTTGT
TCACCAGATATGAGGTGCTAGTGTGTGCTGTGAATGCACTAAGCACAGCAAACGTAGCAGCGGACAAAGG
TGTGGCCCCCTGGAGCTCATATTCTAGTAAGGGAGGAGATCAAGCCAGAGATGAATGGGTGCTGTGATTC
AGGCAACAGCAAGAACTGCCTGAAGGAAAGCAGCGCAGTGGCATGCTGTGGTGGGCTGCCGCCACAGGTA
CAGTGGTCAGGGGTGTCTTCCCTAAGAGCAGATATTGGAGCAGAAACCTGAAAAAAATGGGAAAATGCAC
ATTCCAGGTGGCAGGGGCAGCACGTGCAAAGCCCCTGTGGTGAGGGCGCGCCGGACAGACATGCTCAGGG
CACAGCAAGGGGCCTGCAGACTGGCCCATGTAGGAGGGGGTCAGTGGACCTTGGGGTGGATGCTGTGTTT
CCCTCTAGGAGGGAGGGAAAGACTGCAGGGTTTGAACAAGGGCACTGCAGTCTGGCTTCTGCTTCAAAGG
ATCGCTGCAGCTGCTGGGACTGGGCTGGGGCTGGGGCTGGGGGGCTGCCAAGGAGCACCTGGGCAACATT
AGAAAGCCACTGCATCTGTCCAGGAGTGACCATGCCAGCAAAGGAGGCTGCCAAGGATGAGAGAGGCAGC
CCCTGGGAAGCTCCTGCACTCCCCAGACAGGCCACAGATCCTCTGCCCCAGCCACAGCCCCACCTGGAAC
ACGCCTGCCTGTGCTGCAGGTGGGGGAGAAAGAGGAGTCTTGAGAGTTAGCCCAAGCCTGAGCTCTGAGT
ACTGGGCAGACCCCAGACTCCCTAGGCAAGCAAGAGGGACCGGCAGTCCCAAGTTCTTGAATTCTAGGTG
GGAACTCCATGTGCACAAAGGCATCGGGGCAGGGAGTGCCTGAGACAGTGACCAGGATTTCAGTGGCACA
TGGCACTTCTCACCTTGCCCAAGCTCTTATATCTTTTGTAGACCCTTTGTCTAGTTCGCTGGCTCTTCTT
TGAATTTATTAGCAATGAGCAGATTAGTCAAGAGACCAAAAGAGGGAGGGAGGCGGAGAATTCGCTGCTG
GCTGACGGGGCTTTCCCTCCATTCAGATGCGGCCAAGCTGGGGGAGGGTGAACAGTGGGCGGCTATGCTG
GGGGCACACACATCACCTGTGTAGGCATGTCTGGCCTGAGTCATGGAGAGCCAGCCTGTCCCCAGTACAG
CCAAGCCCCCGACCTTGTCCAGGCAGGTCCTGAGGTCAGGGCCACCTGCTCAGCTTTCCTCCCTGTCCCC
CTTCACTCGTCTTCCAGGGTGCAGTGCACAAGCACCTCCTCCAAGAAGCTCCATTGCATCTCCTTCTGCG
TCCAAGCCCGAGCCCCTCGTGGCCAGGGCTGTGTCTGCTCCATCTTCCTCTGCCTGGCGTCCAGGGTGGG
GCTGGAGGGCAGTGGGTCTCCATGAGTGAGCCATCCCCACAAGCTCTCTCCACTGAGAGGCACCCGAGAC
CAAGAGGCAAGAACAGAACCCCCCATAGACCTTTGAACTCCATAGATCCATGCTGGCCTCTCCTTCATAG
GAAGCTCAGTGACACATCTGTGCTTGTAGAGCACCAGTGAGTATCAAAAACAGCTCTGGTTTCTGCTTGT
TTGTTTTCCTTTTTAGCAGATAGTGCAAGGTCATATCTGGAAGCTGTGTGTATATTTGATAACCTTTGGA
TACACTATTTTCTCTGTGGATGGCAGGATGTTTGAACCTAGAAACCCCATTTCTAAGTTACCATGAAATC
CACATTGTGCAGGGTCTTCCTGAGTGCTGCCAGGGATACAAAGAAGTTTCCATGGCGTCCCTGTTCTCAC
AGGGCTTTTAGTGCCAACGAGGAGAGAGAAATGGGATTTGTGAATCTAAAATATGGGTCAGAAATACTGC
ATGATTCCCTTATATAAGGAATCTAAAATAGGCTCATAGAGGCAGAGAGTGAAAATGGTGGTTGCAGGGA
CTGGGGCAGGGGAGGAGGAAGTGGAGAGTTGCTGTGCAGCTGATATAATGTTTCAGCTATGCAAGATGAG
TAAGTCCTGGATATGGGCTGGACAACGTTGTGCCTACAGTGAACAATACAGTATTGTGCACTGAACAGTT
TGTTTAGAGGGTAGTTCTTATGTTAAATGTCCTTATCACAATAAAACATAAATAATAAAATTAAATGTTG
GTTGAGATGGCAATGAGAGAATGATATTCAAAGTTAATTGTGGGAAGACTAGTGTCAGAGCACATTAGGA
GTGTGTAGTTTCGAGACTGCGGCTCTGGGTAGAGGGCAGCTGAGGTTGCTGGCAAGTATTCTGGCAAATG
ACTCAGCTTGGCCAGGCTTACACACAGAGTGACCGGGATTGGCACAGAGGCCTGGGGTGGTCTCGCAGAG
ACAGAGGCCTGGAATAGGTCAGAGGCACTGAATCAAGGGCCCAAGGGGTGCCAACCAGCACTACTAGCAA
GGTGCGTGCAGAGGACTCTGTTGATTAGGGCCCCAGGTTGGCAGCAGGAGAGAAGCCATGTCACCTGCAG
ACCTAGGGAAACCGAGGGAGGTTGGGGACATGGGATGAAGGCTGTTGTAGAAATTCTGGTATGGGATATA
GGGCTAGTGATGTCTAAGCAGTGGTGAGAAAAGCAAGACCCTTTGTCAGCCCTGGCAAGTGGACGCTGCT
GCTGTTGGAAGGCACCGGGAGAAGGGTGAGGCTGAGACACAGCTAGGACAGAGAGTGCCCACTTCTCCTC
TGGTGGGTGTGGGACCCTGCCGGGCCTGGTGGCCATAGGACCTGGTGGCGCAGGACCCCCTCCCAGGTGC
AGTGTGGGCAGAGAGGTCCCCTGCTTGGCATGAGCAGACAGGCTGTGCGTCCCTGGAACCACTTCTTCAC
CGCGGTGTGGACGTGCCTGCCGGCCAGCAGCTGGCTTCCTGTGGGACACCTGACTCAGCCACTGTGTTCT
GCGCTGTGCCCCTGGCCAGGCATGAGCTGAGCACATCTCAGGCTCCCTCCCACAGGGCCTGGTCACACGC
CCCAGGGCACGTAGTGGCTGATGGTCCTTCCTGAGGGGATGGGGCCACTCAGGAGGAGGGATGTGCAAGG
CCTGAGTGTTCAGAGCATCCCATCCCTAGGGGGCACAGGGAAGGTAGGCAGCTGCTCTGGGGGAAGGGCT
GATGTGTGGACCCCCACAGGAAGAAGGGACTCTGATCATCGAGGGGCTCCTCAACATTGCCTGGGGGCTG
AGGCGGCCCATCCGGCTGCAGATGCAGGATGACCGGGAGCAGGTGCACCTCCCCTCCACCTCATGGATGC
CCAGACGGCCTAGCTGCCCTCTGTGAGTACCCGGTGGCTTCTGTGACACCTGCTCAGCCTGAGCTCCCGG
GTTGGGGATATCCCGAGCCTCAGGGTGGGAGCCCTGTTCCCTTATGGGACACTGGCACAGGAGGGTGACC
CAGCCTCATCCCCATGCCCTGTGACTGCCTCAGTCCACAGCCTCGCCCAGGGTGGCCTCTCCCTCCTTCC
TGGAGAACATTCCAGGCTCCCATGACCTCTATTTCTGTTTCTCAAACCTTCCTGCAAGCCACCTTGCTGG
CAAGAAGGGACGACTACAGCCAGGGGGGCTCCCAACACCTATGCAAGCCGAACATGTCTCGCCATCTCTT
GTTCTATCTTTAAAATTCACACGAATTTAGCCTCTTACTACTCTGTTTTCATTTTAATGTCAAAATTTTA
AAAATAAATTTATCAGAATTTCACATTACATTTGTTTAATATCAGAATAATGTTTCTGTCAGGAGGAAAT
GGTCTCCTGCCTGCCTTACCATTCAATGCACATTTATCTCCTCCTCGGCCCACTCCCAAAAGACGCAGTT
AGTAGCTGGGCCTTGCCTGCTTCTGCAGTAGTAACTCCTGTAGAGGGCACACATTCAGAGCTTTGCCCCC
TTCAGATTTCATATGAAACCCATGCTGTGACAGCACCCACCACCCTGACAGCCCCAGCACATACCTAGGT
GTCCCCAGTCACTCAGCGAATTCTGAGGCACACAGAATTAGAGCATAAAGTCAGACTCCTTAGGAAGGCT
GCAAGTGTGACTCACATGTGCCCCTCTTCGAGGTAAAGCACTCACAGACAGCAGTCGCGGCTGTGCCCGT
GTATTCTCCAGGATCCCATCTGTCTTCTCTTCCCCAGGTCCCCTGGGCTACAGGGCTGTGCCCCATCATA
CCCACTCCTTCTCCAGCCCAGCACTAGCTACCCTGGCCTGGGGCTCATCCTGCCAAGAGGCCTGGAGGTT
GGGCCCTTCTAGGTGGCCCCTGCCTGACACCCCACTAGGCCTTCGGGAAGCCCAGCGAGCCTGTTTGGCA
CACAGCTGCTGGCCTGGCTAAGCCTGGTGTCTAGGAATGCGCAGGCCCTGACTATGTTCATGTGTCCGTG
TGTCTGTGCGATGCAGCCCAGCACAAGCCCTCAGGTCTGCAGGGCCAGGCTCACTCTCCGTCCAGCAGAT
GCTGGGGGGAGGCCTCTACTTTTCTTTTATTGTTTCAGACTGACTCTCTTGGTTTGAAATCCAGGCCTCA
CCTCAGCCTGCCTTGCTTCCCGCCTGTGTCCTACCCCAGGGGCTGCTGGTCTCTTCTCCTTGGCCTGAGC
TCCCTTTCTCTGCCGGCAGCCATCTCAGCCCTGCAGTTGTCTGTTTTCAGAAAGGAGCCATCGCCCCAGA
ACGGGAACATCACAGCCCAGGGGCCAAGCATTCAGCCAGTGCACAAGGCTGAGAGTTCCACAGACAGCTC
GGGTAAGCGGAGCCCGCAAGCTGCCCAGACCCCTGCCTCATCCGGGGTAGGAGCAGAGGGGCTTGGCTCA
CAACCACAATCTCCGAAGGACAGCTTTGTGCCCCAGCCAACGAGGGGCTTCACCTGCTGGACCCCTACCC
AGGTGCCTGCCTGTGAGGTGCTCTGCCCTCATTCTCGCTCCTTTTTATGGAAAAGTGAGCAGAGGCTTGG
GAGGTGACAGTGACAGTGTGGGGGTGGCCTGAGTCCCCCGCCCTGTGTGTGCTATGGGAAACAGGAGCAT
CCACAGAAGGCACTGCGCTCTCCTGGCCCCTCACCTCCCTCTGCGACCTCGTCCTCACCCTCTGTACCTG
CTCACTCATCCTTTTTATTCCCCTTCCTTTAGCCCTCAGTGAAGGGCCTGTTTCAGAGCAGGGGCTCAGA
AGACAGGGCTGGGGCCACCAAAGACCTCCATGGGCACCCTAAGACAGAGACCAAGAGGGGTATGGCCATG
TGACATTGTGACCCAGGTTACCCTGTCTGGGTCTCACCTTCCTATCTGCAAGCTGGGAATATCCAGCCTC
CAGTCCAGGAATGGCCCTCACGTCCCCATCTGCCCCAGTGCACGTGACCACAGGGCTCTAGGGTGCCAGA
TCTCCCGACAGCAGGCAGTTGCTCTGTCAGCATCACCCACCCTGCCATTCTCTCACCCATTTCTCATGCA
GGGCCCCTGGAGGAGGCAGAGGAGGCCCCCCAGCTGATGCGGACCAAGAGCGACGCCAGTTGCATGAGCC
AGAGGAGGCCCAAGTGCCGCGCCCCCGGTGAGGCCCAGCGCATCCGGCGACACCGGTTCTCTATCAACGG
CCACTTCTACAATCATAAGGTGATGCCCCAGCCTGGCCTCTCCCCTGGGCGCATGGGGAGCCAGGCCTGA
GCACAGGCACAGCAAGCACCATGACCTGTGTGGGGGCTGCTGGCATTCCTGTGCCCTCAGGAGGAAAAAC
CAGGTTGCATCCACATAACAGCCCCGTTTATGACCTAAGCATTTTCCAGCACATGCTCACTGTCAGTGCA
TCCTCACAAGTCACACAGAATTCTGGCAAGTAAGCTGGGGATGCCCTGGGCAGACAGTAACGCTGACCGT
GTCTTCAATGAGGGCGCTTTCTAGGAGGCTTCCCCCCGAACTCGATTGGTTGATCCCTGGGAACACTGTG
TATCCAGCCATCACTCTCACCGAATAATTAAGCAGGGGTGTGCCCAGGGCACATGTGTCTGTGCCCCAGA
GAACCTGGACGACCCCAGATTCCCAGCACACAGCCTTTTGTCCAAGGATGCATTGTACTGACCTCAGGAA
AAGCTTTCTTTCCCCAAATTACATCATTCTATAAACAAACTGAACTGTAGCAGGAGAAGTTGATTGTTAC
TGTAAATAGAATGATTGGCTGTCTGGGCAAGGCCCTGGATGGAGCGTCTTGTGACAGGCCATATCTTTCC
CTCAGCACTGGGAAATGCAAGCCGAGATTTCCAGTTGAAGCAGCTGCCCTTCTTGATAGAGGATGACTTA
TGGCAGGGAGGGGGCTCAGGAGGAGGGTCTCAGGGTCCGATCTGAAGGAGCAGGTGTCCCAGGTTAGGCT
ATCCAGGGGCCATTCAAGCCACACTTAGGGTGCCCTGGACTTTGGAATGTCTACTTTGGAATTCTGCTGG
GCAAGCTGAAGGGACCCTGCTTTAATCTCAGGATCTCCCTTCCACCCCCTGCTAGGCTTGTGGTGAGTGA
ATGAATGACAATAGGGTTGCCTTTGCTAAATCTGGAAAAATCCAGGACTATTCCAAAGTAGAGTCTCCTG
AGAGAGTAAAGGGGACCCAGGATTGAAGTTAGGCAGAGATTAACAAAGGTGTAGATTAGCCCAAGGACAC
ATGACATGACTTGAGTATTCTTTAAATCTTGTTCCAAAAGGGGTTTAGTGTGTAATGTGTTGGGTACCCA
TTGTTAGCATTCAAATAAATGTTGATATGCTAGTGTAAGGAATTATTCAAAAATTTTCCAAAATATGTGC
GTGGGTTTAGGTATTTTCCAGTTCTATGTTCCTTACCAAAAAAAGGGTGGGGGCAGGGATGTTTTGCTCC
ATGATTCAAAGTACTGAATGGTGGAGTTTAGCATTGGTACATTCGCTTCTCCTCGAAGGGTCTCATTCAT
CACTAAGAGGTGTGTCTGGTACATTAAACCTTATTGTAGTGATTGCCAGTGTCATAGGAACACTGAGCTC
TCTGCATGTCCTGAGCACTCTGCAGCCTTTGAAATGAACAGTGAGGGTTTTCATCGCAGCCTCTCATTTC
CAACTGAACCACACTATCAAGAAGAGCTACTCAGCCAGACAACATGGGGTCTCAGCCTGTCACCCAGTGA
GGGCAGCTTTTCCTCCTAGTGACAGATTTGCCCTTGCAATGTGAATCCATTCTTCCAGAAAAAAGTACTG
CTTTCAAGGACACAGAATAGTGTCTTAAGCATTTGGGACAGTAGCTCCCCCACCTCCTGGGTAAGGGAAG
TCCCAAAGAAAAGCACTATGCAAAAAGCCCTTTCTTACCACGCTCAACATCCATACAGAACTAATGTCCT
TAGAAATGAGGGGACAGATTCCTTGAGTCAGAGGCAACAATTGAAAAAATAAATAATTCCTAGCATTGAA
TTTCTGAGATAGTTCCAGGTTTTGTTTCTTAGAACTGTGCACCATTACTTCACTCAGTCATTTTCCAAAA
CTGTTCTGATTCCCAGAAATGTTGGTTTTATTTCCAGACAGGGTGAAACTTTGTAGCTGTTTCTACTGCC
TGACCTATTGGATTCAAATGCGTTCTGTTAGAGAGAAACCATTTGTGGTTAGAGATAAGAAAGTAGCCAG
GGGGCCTTTGTTCCTACTTGGAGTTGGTTGGTATCATCTTGAGAAAAGGCTTCGTGCAGAAGAAACACAG
TGTCTTGTTAACAAGACTTTTTGTCCCTTTGAAATAGCCTAACTCCTCTGTTTCATGTTTCTTTTTTTAT
TTGAGATGGAGTCTCACTCTGTAGCCAGGCTGGAGTGCAGTGGCACGATCTGGGCTCACTGCAACCTCCA
CCTCCTAGGTTCAAGCGATTCTTCTGCTTCCTGAGTAGCTGGGACTACAGGTGCGCACCACGATGCCTGG
CTAATTTTTGTATTTTTTGTAGAGACAGGGTTTCACCATATTGGCCAGACTGGTCTTGAACTCCTGACCT
CGTGATCCGCCCGCCTTTGCCTACCAAAGTGCTGGGATTACAGGCGTAAGCCACTGCACCTGGCCCTCTC
TTCCATATTTCTTTGGACAAGAAAGCCTAATCCTAATCCTGGCTTTCTGTATAACTCAGTCATTCTGCAC
CTCAACTAGAATCGAGCTGGGGGAAGCAGGTCGAGGTTGAGTCTGACTCTGGCACAGCGTGCTTCATTTT
ATTGTGCTTCTTGTTACTGTACCTTGCAGATTTTTGCAAATGGAAGGTTGCTGTTCAGCAACCTTCCATT
TGCAAAAATGTGCACTTTTTTTTTTTTTTTTGCTGCACCTGCGGTTTCTGCAAATTGAAGGTGTGTGGCA
ACCTTGTGTTGAACAAGTCTATCGGTGCCGTTTTCCAACACTATGTGCTCACTTTGTGTCTCTGTGTCAG
ATTTTTTAGCAATAAAGTAGTTTTAATTAAGGCATGCATATTTTTTAGATGTAGTACTGTCTCACCCTTA
AGAAACTACAGTATAGTATAAACATATCTTGTATATGCCCTGGGAAACCAAAACATTTGTGTGACTCACT
TTATTGAGATATTCGCTTCATTGTGATGGTCTGGACCTGAACTCACAATGGCTCCCAGGTGTGCCTGGAC
TTATCAGAGCGGGGATACTGAATAGGTCCTTGAGCTCTCTGAGCCTTAGCTACCTCCTTGGGAAAACAGA
GCTAGGATCTCAGAGGAGGAATATGCGAATCTAAACTTGAGTTTGAAAAGCAAGGAGAGGTTCACCTGCA
GAGGAGTCACATTCGCTGGGAGGCACCAGCACCAGGGGGGTAACATGTAGGTTTTCAGGAATCATGGAAT
CCTTTGAGTCAGGGCTCTGTCTTTTCTAGGTGGGTAACTCTGAACAAGCTGGTTAACCTCCTAAAGCCTC
TGATTCCTTTCTAAGAAAAGGGGACTAGTTATAGCTGCCTCAAAGGGTTGTTATGAATATTAAATCAATG
ATTGTATGTAAAATCTTAGCGGGTTCAATACACAGCTAGGGTTTATTGAGGACGGACCTATTATGTGTCA
GGCAGAGTCCTGGTTGATTTCATATATGGTGTCTCTTAGGCAAAGGCAAGATACCTGCAAAAATATAATG
TGTCCCCCCACCCCCCAGCCAAATTGTGAAGAAGCTCTGTGACTGGAGCACATGGTGCTTGTTAGGCAAC
CATAGTGTCATACGTGCGAGACAATGAGAAGAACTACAGATGTTATTGCACAGTCCCCAGGAAGCCTTCA
GATACTTTTAGACCCGCGCTTTCAAACAGTGCTTCTCACATTGAACTGCACAGATCGCTTCGCCTTGTGT
TCTACAGACGCAGACTCTGATTCAGATGGTATGGAGCAGGGTAGGGAAGGGAGCCGAGACTGTATGGATG
CAGCTGGGCTAGACGTCACTTGGAGGTGCAAGGGTTTTAGAAGTCCGTTCCTGTAGGCAGCGGTGCAGAC
TACGGATTAGAGGGACTGAGACCAGAAGGGAACAAGCTGGGAAGCTGATATGGTGTGATCAGTGCCTCTA
CTAGGCACTGCTGGGAGAATGAAGAGGAGGAGACAGATTGGGTAACTTTCAGCCTTAGAATCAACAGACA
ACTGGTGACTTAATCAATAGAAAGAGTGATGGAGAGACTGATTCCCCCACCCTTGTGAATGACTTCCATG
GCCCTGGTTCCTCGGGTCCAGAGAGCTGGCCCTTCTGGGTGTGTAGACATCTTCCTTAGGCCTCTGGAAG
GAGTGCACTACTACAGCTTCCCGGAGTGTCTCCCAGGTCTGGGAACAGCTTATGTGTGCATCAGCGTGAA
TGGACAGGTGCAGGTGTTCCCAGATCTCAGCGTCACCTGCTGCCTTGGTCTGTTCACCGTTGTGATGTCA
GTCCCTTGTCCCCTCTGGGCCTGACCTGAACTTCTCTCCCTTCCTGGTACAGACCTCCGTGTTTACTCCA
GCCTATGGATCCGTGACCAATGTGAGGGTCAACAGCACCATGACAACCCTGCAGGTGCTCACCCTGCTGC
TGAACAAATTTAGGGTAAGCCTGGTCAGGAGCAGCCTTGCCCCAGGATGCCAGTGGTCTGCTATTCTGTT
GGGGGTGGGGTTCTGGGGAAAGCTGCCCGTGGCAGAAGCTGCCTGGGCAGAAGGTCTAGCAAGGGTCCCT
CTGCTGAGCTTTGGTTTCTCGGATTTCAAGCAAGAGGAGGTTGGGAGAGGACAGGTTCCTTGCAACTTGC
GTGTGTGTTACTGGGGGTGTAGTTACTGTCAGGGGACCCTCTCAGTTCTCTCCCATCTCCAAGCACCGTG
ATCTGACTTCCTGTGACTGCCTGTGCAGGTGGAAGATGGCCCCAGTGAGTTCGCACTCTACATCGTTCAC
GAGTCTGGGGGTAAGTACCTGCCCCACTTCTGGATCGTAAAAGCAAAAGGTCTCTACCTGTTCAGCAAGC
CCCCTCCCCACCAACCACTGACTGTACTCCCTTCCAGATGGGCTCCGTGCTGGCTTGCCTAGTGGGCTAG
GGCACACTGTGCCTCCCAGCATGAACATTTCTCCCCCACCCAAACCCAGGCACACTATGGAAGCCTTGAG
GAAAAGAAAACATACTTTTGGCTTCGAATTTAAAGCACATTAAAATGTCCTTGGATTTTCTAGGTCGCTC
AGTACATTAAGTTTAATTCTTTCAGGATTCTGAAGGAGAATCCCACCAAGCTATAGGAAGCCTCCCTCTC
CGCCTCTTCCAGAGAAATGGATGGGTGGGTACCTAGCTCCTTGGCGCCGAGTCAGGAAGGGTGGGGTGCG
TGTCGCAGTGCATCAGGCCCTGGCCCTCCCGTCTCAGCTTTCCTTTCTCCCACCCCTCAGATCTTGTTTC
TCTTCAAGCTGCACCTTTGCTGAATGACACTGTAGGGGAGGAAAATTATCTTCTCTTTCTACCCATTTAG
GTTCACTGGCTGGGGCCCTGTATTTAGATTAACAAAAGACAGATTAAGGAGAAGAACAAACAGAAGTTTG
TTAACACTTGCATCATGCATGCCCTTTGGAATATCCAGGGATGAATGGTCAGAATTTGGGCTTAAATAGC
ATATTCACAAAAGAGCAGTAAGTTTTTAGAGAAGTGACAAGACAGAGGAGAAGGGCCTGAGTTTCTGGGG
AGGCGAAGGGTGGGAAGGTCACCGCACGGGGAGCTGCGGGAAGGGAAGGGCTTCAGCGGGACGTGCTGTG
CAGGTTCCTCTGGTGCCCTCTCCAGGCTGAGGAGGGGCTCGGGTTGTCTCTGGTGATTAACTCCATCATT
GCCTAGAGAGGGACGGGGGCACACCTTGACAAATTTATGTCCTGCTTTTTGGCAAATAGGGGAGGGCAAA
GAGCCTCACTTGTATCTTCTTCTTCTCAATTGCCAGCCGCTCCACTTAATCCTTATGCCAAAGTGGCAGA
TCTGGGGGCCCTGTTCTGCCTCCCTTCTGCATGAGCAGGAATCTCTCAGGGCAGCGCTGTTAGCGAGGTC
TGTGTTCTTAGGGTTCCCTGCGCCCCTAGACGCACATTTTCTATCAGTTCCTAATCTGGAACAGACAGAG
GTGATCCTAATCTCCCGTGATTTTTGTAAACCACCTTCTTTTTCAGAGCGGACAAAATTAAAAGACTGCG
AGTACCCGCTGATTTCCAGAATCCTGCATGGGCCATGTGAGAAGATCGCCAGGATCTTCCTGATGGAAGC
TGACTTGGGCGTGGAAGTCCCCCATGAAGTGAGTGGGGGCCAAGGCTGGGGAGGCCTGCTCTAGGGTGAG
GGGTTCTTGGGTGACGGGGCCTCCCAAGGACTCCTGGCCAGAGCCCTGTCAGTTGATGTCTCCAGGAGCT
CCACACTCTCCCAAAGGGCTCCCAGCCTAGCACAGGGAGGCGCCAGCCCTCCCTCTCCCATCAGTGACCG
CCAGCACCAGCAGCTTAGGGGAAAGAAGAATTTGGGTCCTATAAAACCATGGCCTGTCCTTTTCCTCTAG
GGAAGTAAAGTCTTTTCCTTCATTGGAATGTATTTTGTTGTCATTATGTGAGAGACCTATGCAAAGGCTT
TTTAACTAGGCCCTACCTCGCACCTGTGGAAAACAGGGAGATATTTAAGTCTTACCAACAGCCTGAGTTC
TGACCAGACAGTGAGTGCATTTCCAAACTCCTCTGCATAGAAGATGCTTACAGGGTTTGAACCTCAAGTA
GGAGGCCTAGTGACCCCGTATCCCTCAGGCTGCTGCAATTGCATTCCATTGTTAGAAACAATGGTGCTCC
CACCTCCCTACCCCCTAGCCCAGAGGGCACCCAATGTGACAATGCTGCTGTACTGAATGCTCTTCCTAAT
ATTCAGTTTAATATTTCCTCCCAGGGATAACAGTTGCCTTTGAGATAGTAATAGGCTCCCGTCCTGGCAT
CTGTACACAACACAGCAGTGTGGGGGTGGGGTGGGAAAAGCGGCAGCTCCTTCTGTGGATACAAGATGTT
GGCTGGATGGGCCACTATGGAAGCCTTGAGGAAAAGAAAACATACTTTTGGCTTCGAATTTAAAGCACAT
TAAAATGTTCTTGGATTTTCTAGGTCGCTCAGTACATTAAGTTTGAAATGCCGGTGCTGGACAGTTTTGT
TGAAAAATTAAAAGAAGAGGAAGAAAGAGAAATAATCAAACTGACCATGAAGTAAGCAGCACTTAAACAG
ACAGTCATGGGTCCTGAACATCAGGGCAGGTCTGCAAAGCACAGCACCAGTGCCGGCTGGGAGGTCTCTC
TCCTCCATGGGCACCAGTACCCTGGTACGGGAAGGCCTGCTAACCCTAGCTCCCCAGCATCACCCTCTGG
CCCCCTGCTCGGTATTGCCACCACGCTGGGGTGACAGCTTGCCAAAACAGTGGGACACAGCCCCGATCAC
CCATCCAGTCTTGGCATCCTCACCAGCGCAGGCATGAGCTGCAGAACACCTGGCAGGAAAGTCAGGCAGG
AACCCAAGTGGGCGCTGGGTCAAGCTTCTGAGTTCTGCTGGTGATGTGGCTCCAAGGAGCAGGCATGCTG
AGGCAGACTTGGCCTGATTAGGGCCTTTTGTCCTAGTGGGAATTCTGAGCCTTCCCCAAAGTGGCAGATG
CTGGAACTCCCAGCCTCAGCCGATGTTTTCAGGTGCAGAGGGCTAGTTCAATGAAAAGGTGAGCAGGTCT
CACCTGCCAGCTCCTGGGGACACCACGCCAGGGTCCGGATGCATGAGTTAGCCAGGCTGTAGTCCCAATG
ACGTCTCCCCCTCAGCAAAGTGAAGTGTGGTCCAGGACTTGTGGAGGGCACCCCACCAGGGCTGGTGGGG
AGGCAGCTAGGAAGGAAAGGGCAGGAGCTCACTGAGAGGGCCTGGGGTGTGTGGGGAAAGGATGGATGTT
AGCCTCTGGTTGAATGACCCGTGGAAAGCCACATCCTCCACAGGCTCCTGTCTGTGCAGCCAGACCCCAA
ACAGGCAGAGGAGACCAAAGTCAGAGGGAATCTTCCATTCTGCAGTCAGTCCTGACCCCGTAAGATTTGA
GAGCTGAAAGGGATCTGGGGGGCAACTAGTGGGTCCACTCAACGTACAGAGTGGACGCTGAGGCCCAGCA
CAAGGAAGGTTGCCGCATAGGTTATGGCAGAATCTGGGCTGAAACATGGGCTTCCCGATCTCTGCTCTAC
CGCCCTGTCCACTCCAGTGTGCTGTTGTCTGTATTAGAGTCTGCAATAGAAATGACAACACTCTGCTCTG
ATGCTCTGTGCAGTCCACAGCCTGGTTTGACTGCACCTCATGAGGCGCAGGCCACAGCCTTCCCCCTCCT
TGGCAGAGGAGAGATGAGGCTGCTGCAGGGATCTCCTGAGCTGGCCATCTGCAGGTCCCTTGCTCTGCTG
CCCACCTCCCTGCCCTGTCTGGCCTCAGTGAGTCCTCTTGGCGATGTCTCCCTCCAGGTTCCAAGCCCTG
CGTCTGACGATGCTGCAGCGCCTGGAGCAGCTGGTGGAGGCCAAGTAACTGGCCAACACCTGCCTCTTCC
AAAGTCCCCAGCAGTGGCAGGTGTACACTGAGCCCTGGTTGCTGGCCCCGGCCGGTCACATTGACTGATG
GCCACCGCCTGACGAATCGAGTGCCTGTGTGTCTACCTCTCTGAAGCCTGAGCACCATGATTCCCACAGC
CAGCTCTTGGCTCCAAGATGAGCACCCACAGGAAGCCGACCCAGGCCTGAGGGGCCAGGAACTTGCTGGG
TCAGATCTGTGTGGCCAGCCCTGTCCACACCATGCCTCTCCTGCACTGGAGAGCAGTGCTGGCCCAGCCC
CTGCGGCTTAGGCTTCATCTGCTTGCACATTGCCTGTCCCAGAGCCCCTGTGGGTCCACAAGCCCCTGTC
CTCTTCCTTCATATGAGATTCTTGTCTGCCCTCATATCACGCTGCCCCACAGGAATGCTGCTGGGAAAAG
CAGGGCCTGCCAGCAGGTATGAGATCTAGCCTGCTTTCAGCCATCACCTTGCCACAGTGTCCCCGGCTTC
TAAGCCTCCAATATCACCCTGTGAGCCTCGCACAGCTCAGCCCCAACACAGAGGTGAGACCAGGAATAAG
GCCACAAGTATCTCACTTTCTCTGCAGAAATCAATCTTTACTTCATCAGAGAGACCTAAAGCGATTCTTA
CAAGGAGCTTGCTGCAAGAAACACGGTCATTCAATCACATTGAGGAGGGTCCACATGGCATTGAGAGGGT
GCTGCCCGCTCAATGCCCAGCAGCAGCTCTGGAAGGCAGTGCTCAGCCCCATCACCACTGTCCCGTGGAT
GCCTGTGTACCTCTTGCCTTTTCTGGGCTTGCGTTTCTCTCCTCTAGTGGGTGGGGATGACTTTCAATGA
CTTTCAATACTTCCCCTGAAGGAAGAATGATAAGGAGAAATGTCTGTTTTGAGGAAAGGGCTTTGAATTC
CCCAGATACTGAACAATTTGTGTTTGTGACTGATGGAGAATTTCAGGAATGAATGAGAAAGCCTTTGCGA
AACTATGCAACAGTTTACATCAGTCATGTGAAGTATTTGTCTAAAACAGAGCAAACTGAAGACCAAATTA
TTCTCCTGTTGAGGTCCGTGGATGGCAGATTTAAAGGGAAGAACCACAAAGGCTTGCAAAGATAGGAGAG
GCTCCATCTCTAATGCATGTAGAAGCTCCTTACGGGTGCCCATCAAGAGCATAGCTTGGAAGCCACCATG
CTGTGCGGAACTGCGTCAGGGCAAATGTCACAGCAGGATTTCCCCAACCCAGCTCCATCATCACAGACAC
AGAGAGCTGCAGGGGAGGCCTGCCCACTGTTTTGTCGACTCTGCCCTCCTCTGGCAGCATAGATCCTTAG
GTGCTCAATAAAGGTGTGCTGTATTGAACTGAAGAAGTGAGA

Protein Sequence
>NP_114412.2 ras association domain-containing protein 4 [Homo sapiens]
MKEDCLPSSHVPISDSKSIQKSELLGLLKTYNCYHEGKSFQLRHREEEGTLIIEGLLNIAWGLRRPIRLQ
MQDDREQVHLPSTSWMPRRPSCPLKEPSPQNGNITAQGPSIQPVHKAESSTDSSGPLEEAEEAPQLMRTK
SDASCMSQRRPKCRAPGEAQRIRRHRFSINGHFYNHKTSVFTPAYGSVTNVRVNSTMTTLQVLTLLLNKF
RVEDGPSEFALYIVHESGERTKLKDCEYPLISRILHGPCEKIARIFLMEADLGVEVPHEVAQYIKFEMPV
LDSFVEKLKEEEEREIIKLTMKFQALRLTMLQRLEQLVEAK

Molecule Role Protective antigen
Related Vaccines(s) FluMist
References