VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign2
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

KCTD12

Gene Name KCTD12
Sequence Strain (Species/Organism) Homo sapiens
NCBI Gene ID 115207
NCBI Protein GI 19923973
Genbank Accession AC000403
Protein Accession NP_612453
Taxonomy ID 9606
Chromosome No 13
Gene Starting Position 76880168
Gene Ending Position 76886404
Gene Strand (Orientation) -
Protein Name potassium channel tetramerization domain containing 12
Protein pI 5.29
Protein Weight 34211.58
Protein Length 325
Protein Note Also known as PFET1; PFETIN; C13orf2
DNA Sequence
>NC_000013.11:76880168-76886404 Homo sapiens chromosome 13, GRCh38.p12 Primary Assembly
GGAATAATTAAAGGAGTGAATGTTTTATTCTTTAGTGTTTAATTGAATACATAACAAGTCACATAATCAA
TGATTCATTACTTCACACACAGGAAGGAAAACAGTAGCTAGTATTTCTGTTATACAACTGGTTGTGAACA
GGAAGAACAAAAATCTTTATAGCATTAGATGGTTGAAGAAATTCTCAAAGTTTGGGCATGTCTGAAAAGA
CTTTGACTGCATCTTTTTTCAATATAAAGGGATTTTTTTCTTACATTTCTGTGTCATTAGAAAAATCTGA
TAATCTTATAAGATTTTTTCTGCTCTTCTTACATTTAGAGAAAATGGTTTAATGATATGTACTATTTAAA
AAATCAGAATCCCAGATAACTCTGTGTGAATCTTACATTGTCTAGCAGATAAGGTTTTCAGATGCCTGGA
AAAATTTAAACAACATATAATTTACATCTTCAAAATTAACATCCAGATGGATGTTTTAATCCTTTGTCAC
TAAATGGTTACTAACGCTGTTTGAGTGGTCATAAATGAATTGTCATTTGTATTCAATAGTAATAGCAAAA
TTTACCTGCCTATAAAGTCGCAAAAACAGTTGTATAATAGTTTACATTACAATTAATGTACCCATACCTC
AAAACACATTTAGAATTTAAAAAAACTGGCTTGGAAAAAAATCACAAAAAATTTAAGTGACAACAAATCT
TGATTAACTAGTCCATCTTCCTACCACACATGATTATACTCTAATGTAGATATTCTGGTTGAATTTCTTC
CAACCAAGTTTGAAGGGCCCCAGTAGAAAATCAAGTGTTAATACTTTCAGATTTTTATTGTCCAAAACTG
TTGACAAAGAAAAGCTAACTTCAACATAACTTGTTTCTGGCTATACAAAGACCTATTTCAGGTGCTACAG
ATACTGAAAATAGGAGTATTTTACTTATTTCTCAAGAGACAGACTTATGCCATCTAAGAAAATGAATTCA
GTTTTTAAATGATTTATAGTAAGGAAAAACAGGAAAACAATTCCAAACGAAGGATTGACTCTGATAGGCT
TACAACAAAAATATTCAGTTTACTATTTTAAAAACTAAATTGAGTAAAGTATTTGTGATTTAGACTATAA
AATAAATTCTCAAGGAATTCAACCCCTCCAGTCAATACTTTTTCTTAATGTCTGCATTGTAATTTAGCAT
TTTGCATGTGGGAGTACACAAATGAATTGAATATTGGATCAGAATTTACCCTAACTTGAAGAGTAAAAAG
TTATCAAAGTTTCACCTTACATGGCTTTATTGAAATAACATTCCATCGAAAATTCCAATAAAAATTGGAA
TATATTATGAGCACTGCCAATTGCTCATTTTGTCTGATATTAACAGATTATGCATTTCCTCAGAGAAGCA
GTAGGTCCCATATATACAGACATATATATGGCTCTGGTTTGAAAGAGAAGACAATTTTGTCTAGTATTAT
GATTTATCACTGTGCTATCAATCAAAAACCAGTAGAATACATAACAACATTGAAAGGGAAAAATTTTTAA
ATCTCACATCTTCAAGGAATATTTTCTACAGCATATCATTTGAAAAAGTAGAATGAATACTGTTCATGGT
CCACATGTATTAAAAAACATGTCAATTACTTGGTGCAAACACACAGAACCTGGTACCTGTTTTTTTTTTT
TTTTTAACCACCATTGTCTACACCTTTTTAAAAATTAAGTTTGTTACTAAAAGTCCAATGTCATTCACTT
GTATTTATGATCATCAAATGGTAATTAGGGCAACATATGTAAATGCATGCCTCTGAATCAGATTCATGCA
GTGTTAATTATCTGAATAATTTATGACATTCTCCCAGGTTATTTGAATGGTATCTTTGGAGGGCTTACTC
AAATGAACCCACAATACCTCCACTATTACAGCTTATAGGAAATTACAATCCACTTTACAGGCCTCAAAGG
TTCATTCTGTGGCCCAAAGCCCATGGAGGGGAAGGGATCTAAAGGTGCTCATGTCAAGTTATTTTACTTG
TTTTTTACTGTCTACCCAATGTAAAATGAATTTTCTTCACAGCCTTTACTTTAGGCTAAAAATAGACAGT
TTTCTTGTATTGACTTTAACTTTAGAGGGGACAGTCGTCCCTGGAAAAAGAAGTAGATTTACTGTCCCTA
ACCATTAAATTCCCAGTCTTTCAAATAATGTGCGGGGCGGGGGGTGCTGGGTGTGACAGGGTGCAGTGAA
TAAGATGCCTATGTACAAGACAGTGGAATAGTTCACCTCAAAGGTTTACAAGATAACATTTGTAAGACTT
GAGTGACAGAGGCAAAATTTTAGCAGTTTCTCAAGACTCTTGGAGTTGAGCAGATTTGAGAAGGGAAATC
AGAATCGCCGAGCCTTGCCATCTGTCAGTGGTTTTGGTCTGTCCCAAGATGTTCTCAATCATGTGCTTCC
TGTTGAACAATCTAACAAAATACCATACGGGGTAGAGAAATCTCTGCAACACTGACTTTTGGTCAGTGAA
TCAGAGTCCTAAATTATTTCAGGCTTCAAACAGATGAATTCTGATGCATTACTTAGTCTGAGACCAAACT
CAACATACAAGCAAGCACAACTTCCTAGATTTCTGCTTCCATTTCGCCTAAAATTACAGGCTTTGTATAT
GAAGTCAATTTTACTTCTCAAAAAATGTTAGTCTAATAAAAGACCTGAAATCTATTTCCCAACTAAAAAA
AAATTAGTGGATTAAAAATACAGGTACCTTGACTTTAAGTAGACAGTTAATCAACATATGATTAGTAATA
CAACTAATACTCAAGAAAAAAAGTATAATACAGCAAACTCAGTTTTACAATTATGTATTTTTTCCTAACC
CAATTCCTCGATAAGGATGTAAGAAACTCATCAAAACATGTTGCTTTAGTATATAAACCAGCTGATGCAA
ATTACTGGGGTAATATAGGAAATTTTATAGCATTAGTAAATGAATTAAAAAACTAAATGATTCATGTAAA
ATGTTTATATATGGTATATACAGCTTGGATCACATGAGTCTAAGAATAAAACTGTCGATTTGTAACATCT
GTATGGACATAGTAAGATACAGTACGAGATTCATTTTTAAAAACAAGGAAAAATAGCACTAATTTAAACA
CTGAAAACAGCTCTTACAAAATCCTTAAAAACGTACATCAGAGAAAGATGCTGAAAACAAAACAAAATAG
GCTTCTCTGTCATCACAGAATATCCAAAGGACACCTCACAGCATGGAGCATGACGAGGTTTATTTCCCTT
CACTTATGGTTTACATAGGATATGCATTGGGAATTTATTCCATGTAAGAGTAAAGGCATAAGGCAACCAG
GTCTCCTTCTGTTTCTGTTGCATTTACCTATTATTGGACCATTTTATTGCTCAGCTCACTTTTAAGTACT
TATTTGCCTTCATTTAAAAATATTCCATTTTACAGCTATCTACAGATAGGCAGCCCTTGGTGCTGAGTTC
TCTGCAGCTCGTCATTTGAAAGGATTCCACTTAACTTCAAACAAACTGCATGAAAGTGGCATTTTCAGGT
TTTCAGGTTTGCCCAGAAGTCAACGTTTGCTGGGCTTGGAGAAAATAAGGATTTTTAATAAGTGATCTTA
GGTCTAAGTAACCAAAATGAAACTTCTTTTGCGCAATAGATTCCAAAATCAGGATTTATAATCAACAAGA
AAATAAAAGTTCAAAAACTAAAACCCTACTGGGTAACTCTTTGGTTAGATTATATATAAGCATTAACAAC
TCTAAGTTTAGGACTCAAAACAGTAAGTTAAGTAAACTGCCAGGTAAGAGTAGGTCTGTTATTAATCTTT
ATAAAATACTTGGCATGTTTGCATTTACTATATGATATTTTTTAAATGTGCATATACTCAAACAGATGGT
ACAAACTTCCAACTTTCAAATCATAAATGACTATGTCTGCTTCTCCCTTCCCACCCTTCCTACCCTTTCC
TCCCTCCCCACCCCACCCCGCCCACCAAGTCTTACAGCTAAAGGAAGGTCCTACTGACATTCATTGAAAG
AATACAGGCTTTCCTAATACCCACGACGTGCACTATGACCCAGCTCCCTACAGTCACTGCCAGGTGACCT
CCTACGGCGCTTGGAGACCTGAGCAGCCTTGCACTCTTAGGCGGCAGCGTCCTTTCTCCCTCTTGCCAGT
AACTGCTGCCATGTCAACCAGTGGAATCAAGGGCTTCTGGCGAGCAGCAGCTGAAAAGGGCGCCTCTGCA
GGCAGGCGGATCACTTTCTATAAGTTTAAGCTACAGGCTGAGACCTTTTATTCTGTACGAGAAAGGATCC
TTTACTGTCCCACGCACTAGATTCTTCTACTTTACGTGTAACTTTTCAAAACTTTATTAGTTTAGTTACT
GAACTGCCTCCATGGGGTCCTAATTCCAGGCTCAGAATCTTCCATCCAGCCTTCTAAAACTCTACCTTCA
AAAGAGGTCAAAAAGACTGTGTAATGACCTTGTAAAACACTAACCCCAGACAGTGGAACCAATCCTGATC
TCTTAAACCCCCAGTGAGTCATAAGAGCTTGAGAAGATTTCAAGGAAATCTTCCGCACATTGGACACGGT
CCAATCAGGTTCTGAACAATTCAATCATCCCCCGGTCTGTGGCCACACTCCCCCAATAGATCCAAACTGA
AGTACCATCTGGGGGAGGGGTGGTTTGAGGCAGGGAGTAGAGAAAGCATGGAGTGGTAGGTGGGGGTGGG
GTGGGGGTTCCTCTGGGTTCTCTCGGTTCAGGAGGTCCAAAGAAGACGAAGCAGCCCAGAGGATTTGCGG
CTGCAGGTTCTGTAGTGGAGGGAAGGTGGGCGGACAGGTCTCACCCAGCTACTACTGGAGGGGGAGAATG
GGAGGGCAGCAGCCAGGGGACAAAGGTGGGACAAGAGGCTCTGTAATCATCTCTCGGGCAGGAGAAGGAC
TGGGCGCTGGAGTGGCGAGGGGGTCTGGGGAGCTCACTCCCTGCAGAAGACGTACTCGGTGTAGCTGGTC
CAGATCTTGTCCTCGCTCTGGTCGGTGCTGCTGGCAAAGGCGCAGGTGCCCGTGGAGCTGCACGCCACCA
TGTGGAAGCCCGACTCGGACAGCTTGTCGAAGGCCTGCTCCAGGAAGTTGAACTTGAGGTAATAGCGCGA
GGTGTAGCGCTCCGGGGGACGGTCGGGGTCCCGGCTTTCGTTCAGGGTGTCCCCAAACACCTCCTTGGCC
AGCGACGTCTTTCCGCAAACGGTGATGCGCGCCACTCGCCGGAACTTGGCGTCCGCCTGCGCGTCCCGCC
CGATGGTGTAGGAGCCGCGGTAGCCGATGGTGATGTAGCCCGAGCGCCGGCTGCCGTCCAGCGACTGGGA
CGGCGTGAGCAGCGGGCCCGCCGCGCCCCCGGACGGACTGCGGCTAGCCAGCTCCAGCGTGGGCGACGGC
GCCCCGGCAGAGGCGCCCTCCTGCTGTTCGGGCTCCGAGTAGCCAAGCGGCAGCAGCTCGTCACCCAGCG
AGCCCTCCTTGTGCACCCCGCGCCGCGAGGGCGGCGGCCCCGGGCCGGGCTGCTGGGGCGCCCCGAGGCG
GCGCACGAGCTCTGGCAGCTCGAAGTACTCGGCCTCGCGCTGCAGCCGGCTGCGCTCGGGGAAGTAGTCG
GGCAGCACGAGCTGCAAGTCCCGCAGGTAATCCAGGATGTAGCGGAAGAGGAAGCCGTCCCGGTCCAGAA
AGAAGCGGCCTTTGCTGTCCCGGGCCAGCTCCTGCGGCTGCTGCTGCGTGAACATGCGCCAGAGCAGCGA
GTCGGGCACCGACACCACCGTGCAGCGCCGGGTCACGTACACCTGGCCCCCCACGTTCAGCTCCACGATG
TCGGGGAAGAGCGGTGGCTCCGCGGAGGACGACGAGGAGCCACTGCCGCCCCCGCCGCCGCCCCCGTTGG
GTAATCCACGTGTGCTGTCCGCCAGAGCCATGACAGAGAGGTGGCCGGGCCGGGACAGTGGCAGGAAGCC
GCGCTGCACTCAGGAGCTGCAACCGCCTTCCCCGGAGCCCCGGAACCCGGACGCTCGCTCAGCCCTGCGC
CCCGCCGCCGCCGCCGCCGCCACCGCCGCCACCGCCACCGCCGCCACCTCCTAGAGCCGCGCGGAGCCGA
GCGGTGCGAGCGCGCCGCTGTGCGCCCCCTTGAGTTCCAGTGCGCTCCGCCCGCCTTGCCCGCGCGCTCC
AGGCGAG

Protein Sequence
>NP_612453.1 BTB/POZ domain-containing protein KCTD12 [Homo sapiens]
MALADSTRGLPNGGGGGGGSGSSSSSAEPPLFPDIVELNVGGQVYVTRRCTVVSVPDSLLWRMFTQQQPQ
ELARDSKGRFFLDRDGFLFRYILDYLRDLQLVLPDYFPERSRLQREAEYFELPELVRRLGAPQQPGPGPP
PSRRGVHKEGSLGDELLPLGYSEPEQQEGASAGAPSPTLELASRSPSGGAAGPLLTPSQSLDGSRRSGYI
TIGYRGSYTIGRDAQADAKFRRVARITVCGKTSLAKEVFGDTLNESRDPDRPPERYTSRYYLKFNFLEQA
FDKLSESGFHMVACSSTGTCAFASSTDQSEDKIWTSYTEYVFCRE

Molecule Role Protective antigen
Related Vaccines(s) FluMist
References