VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign2
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

CD1D

Gene Name CD1D
Sequence Strain (Species/Organism) Homo sapiens
NCBI Gene ID 912
NCBI Protein GI 982742445
Genbank Accession AF142668
Protein Accession NP_001306074
Taxonomy ID 9606
Chromosome No 1
Gene Starting Position 158178037
Gene Ending Position 158186426
Gene Strand (Orientation) +
Protein Name transcript variant X1
Protein pI 8.22
Protein Weight 26015.73
Protein Length 242
Protein Note Also known as R3; CD1A; R3G1
DNA Sequence
>NC_000001.11:158178037-158186426 Homo sapiens chromosome 1, GRCh38.p12 Primary Assembly
GAGTTTTGCTCCTGGGACTGGACGTCCGAGAGGTAAGAGAGCTATCACAAGGTTTTCTAATCCTTATGTT
TCTTTTAGTGGATCTCCAGGTTACTGTGGTTTGTATTATCAGGCTACTTACAAAAATGAATACCTCTTTA
AATCAGGCCATTTTACAGCAAACTACGGTCCTTGATCACCATTATGCTCTGAATAAAGACTATGAGCAAT
TGCACTTGAATGCTGTTAAACTTTATTGACTGAACTTTGAATTGTTTGATTTTGATCAGGTTGGCTTGTG
GAAAGTGCTATTAAGAAGAGTTCTTTAGTTCGTTGGTATTATCCTCCTGATAGCTATTATAAAAGTTTCC
CTGATGTGTCCTCTCAAGAATCTTAAATTCTCATATGCAGCTATCCTTTGTACATTAAATGGTCTCCTTA
TGGTTAGGATAACAAAAACATGAAGAAAGCATATAAGATTCCAACTAATTTGACGTTGTGAATTGTGAAT
TCTGAACTGAAACCAAGTAAGTCCCTTATGATCAGGCTCCAAGGTTTTGGTCAGCCTCTCAAAATTGAGA
GGCTGAAACCCTTTGACCAAAATTAACACATTTGCCCCTTCCCTCCAGCTCCTGGAAACCACTACCCTAA
CTCTGTTTCCATAAAATAGTAAACTATTTTAGAGTCCACATATAAGTGAGATCATGTAGTACCCACCGTG
GGCTTATTTTAAGGCTCTGAGTAAATCACCATCTCTCTGTGCTAGGGTATTCTGAGTCAGTCTTGTTATA
AAATATTTTGTTTAGGTAACATATTGCAAAACGTTTCATAATTCAATGGTTCCTTTCCCAGAAAAAAAGC
AGTGAAAGTTCCAATAGCCAAAAAGTGTCTAACTCAACTGACCTTTGGGAAAAAATATCCGTATAATTCC
AGATAGTCCTAACTTCTGAAGGTAATATAGCCTGGCCTCTGTTGATAAACAAACAAAAACAAAAAAACCA
CACACACACACACAAACCAGCTTCTTGTCTTTAAGTGTGCAAGAATGTTAGCACTTAAAATTTTTAAGAT
ACACAAAAACTAAACAGAACTGTTCAAGTTTTTAAAGGGAGCTTGGAAATTTGAAGAAAGTAAAGTTAAA
AATATTGCCCCATGAGTCATATAATTATTTTTCTTTTTATTTCTCATAGCTTCCCTCCTATCCATTATTT
AGGCAATTTTGTATCCAAATTTAATAATTTAACACCTTATTTGTTACAAGAACACGTTACTATGTTATTT
TAAGCTTTTTTGGGCAAATTACACATAATTAGATAGGCTGGGTTAGGGCTGTCTACAAGATCCCAGCCTA
GAGTGTGGTGCAGTAGCCTATTTTCTCTAGGACTCTTGCTGCAACAGGATATGGGAGAAGGGAAACATTA
ACGTTAGCAGAATGGGAGGAATCAGATTATGGAGACATGATCCTTGCCTTCTGGCACCTCTCCAGCTGAT
TTAGAAGAGGACACAGAGGGAGACAGACATATGGCCATTTCTATAATTATAAACTCTGCTACATGCTGAG
AGGATGGCTTCTCAAAGCCAGTTAGTGTACAAGCAGTGGAGGTTGGGACTGCCCTACTTCTCCTGCCTAG
GGTCACACAGTCTGGCAGATCTGGAAAGACTTCCCTGAGAAAGTGACCTTGGAACTGATACCTTAGTGGA
AATAACTAGGCATTGGGAGGGGGTGAGGTGAGGAGAAGGTCAAGAGCTTTCATGTAGAGGGAACTTTGTG
CAGAGACCTTAGTCAGGAAGAGGTTTTGCATAGTGGAGGAACTGAAAGCTAACAGCCAGGCTACAGTACA
GAGCAAATGATGCTGGGGTGTGAGGTGATGTCAAAAGGTAGACACCAGGGCTAGAGGGCGCATAATCTTG
CAGGCCGTGCTAATGATTTTGTTTTCTACCCAAGAATGCTACTTCAGGAGATCAGTCAAAAGGTTAGGGT
GATGGTGACGGTGGAAATATAGAAAAAGGAATTTATTCAAGAGGTATTCAAAAAGAAGTGAAATAGAGAT
GAGTTGGAGATAGATTGGATAAAAAGAGTGAGGGAGAGGGAGGTGTCAGGCTGCAGCCCAGGTTCTGAGT
TGCCAAAGAGGAGTCTTTTCCTCCAGGTGAGCTAAGGCTTAGAACCACGATTTTTGGTCACTTTTTCTTA
TTTTCAGTGTGAGAAGTGGCGAGTTGGCTGTCCAGGTACACACTGTCATCTTACACTTACTGTTTAAGAC
AGAGGCGCATATTTGGAAAGTGAATGAGTCAGGAGCCAGAGGAGAAGGTATGCCGGCAGAGCCTAGGGCG
GAGAGGAGGAAGAGAGTCTGGGGGCGCGTCCCCAAAAAGGAGACAGGGAAGACAGAGCAGAGGCCGGGGA
GGGGAGAGCAAGGACCATGACAGGAGGAAAGAGAGGCTAGGGAACACTGAGGTGGAGGAATCCTGGGATA
TGACAGTTGTAAAGAATTGTAGCCAACCTAATCCAGTTCTCTCAATGTGCAACTGAGGAAATTAATTTTC
ATGCGTTTACTTTATTGTAAATGTGGTACTTGCACTTGAGAAATTTTGGAAAACATAAAGATGTAAAGCA
AATTAAGATCACTCATAGTCTTTCCACCTAGAGACATGTACTGCTAAAGCAAGGACTTTGATCCTTTTTT
CCCTTTGCATTTTTACCATGGTTGGAATTGTAACACAGACACAACCTTATGTCCTGCTTCCAAAACATAA
ATAATGGTTGTAAAGCGTCCCACACGTTGACCCAAAGTCTCCTTTGAAACAGGAAATTGAGACACGCCGG
TTGTGAAACCTACTGAAGTGAGCGGCGGCGCCAGGATTCCTGGGACCCCGACCTCTTTGCAGCTCGCACA
GCTAAGGGCGAGGGCGCCCTTCGGCAGAAGCAGCAAACCGCCGGCAAGCCCAGCGAGGAGGGCTGCCGGG
GTCTGGGCTTGGGAATTGGCTGGCACCCAGCGGAAAGGGACGTGAGCTGAGCGGCGGGGGAGAAGAGTGC
GCAGGTCAGAGGGCGGCGCGCAGCGGCGCTCCGCGAGGTCCCCACGCCGGGCGATATGGGGTGCCTGCTG
TTTCTGCTGCTCTGGGCGCTCCTCCAGGCTTGGGGAAGCGCTGAAGGTGGGTGGAACGAGGGCGCTTGAG
TGCACTCGCGGGAGGGCGGAGAGAGGGAGCTGGGTAGGGACGGGGAGGGCAACGCCTGATGGGGACTGGT
GAGACCCGGGACGCACTGGCGCGATCTAGGTAGAAAACTCGCTGCTCCCTGGCTCCGGGGAGAGGCAGCG
CGGCACAGAGTTCGCTGGCATCAGCCGCCTCCTGAAGCTCATCTCCTCTTGTTTCTTTCTTCCTTCTCTT
TATGCTGGCTGCTCTCCCGGCCACTTGCTACACGCCTCCAATCTTCATTCTCTCCCAGTCCCGCAAAGGC
TTTTCCCCCTCCGCTGCCTCCAGATCTCGTCCTTCGCCAATAGCAGCTGGACGCGCACCGACGGCTTGGC
GTGGCTGGGGGAGCTGCAGACGCACAGCTGGAGCAACGACTCGGACACCGTCCGCTCTCTGAAGCCTTGG
TCCCAGGGCACGTTCAGCGACCAGCAGTGGGAGACGCTGCAGCATATATTTCGGGTTTATCGAAGCAGCT
TCACCAGGGACGTGAAGGAATTCGCCAAAATGCTACGCTTATCCTGTGAGCTGAGGGATAGGATCCTGGG
CCGGTACCCAAGGGGAGAGAATGGCCACAGAAACTCAACTGGGAGACTGTGGCACCACCTGATGAGATTC
TCTGCTCTGTCCACCCTCTTCTGATTTCCCTTCTACCTGGAGATGTCCCAGGCTTTGACTCCTCAAAGTG
TCCCTCGTTCCTGCCTACTCCAGGTCACTTACTTTCCTTTCCCTGAAGTCTGGGTCCCCATTATAACCTG
CACATCAATTTCTTCTCTTTCATCTCTCCCAGTCTTTTAAACCCTTCTTTGATCTTTCTCCATTCCTCTC
CACAGATCCCTTGGAGCTCCAGGTGTCCGCTGGCTGTGAGGTGCACCCTGGGAACGCCTCAAATAACTTC
TTCCATGTAGCATTTCAAGGAAAAGATATCCTGAGTTTCCAAGGAACTTCTTGGGAGCCAACCCAAGAGG
CCCCACTTTGGGTAAACTTGGCCATTCAAGTGCTCAACCAGGACAAGTGGACGAGGGAAACAGTGCAGTG
GCTCCTTAATGGCACCTGCCCCCAATTTGTCAGTGGCCTCCTTGAGTCAGGGAAGTCGGAACTGAAGAAG
CAAGGTCAGCCTGCCTTCCTTACTCCCTGCATTCCACTTCAGGGCTCCAAACGGGCTTTTCCATTCCAGG
GTTCTCATCCCTTTGAGCATTCAAAGAAGAGGAAGGCCCAGGAGGGGCTGGATAAGGGGTGAGGGTATTT
ATTCATTTCACAGACATCAACTGAGCACCTCTTGGGTTCTATGAATTCAATTAATGAACAACTGGGGGTG
AAAGGTGTCAGGCAGTTAGTTAGGATCCCTGCTTGGTAGGGGGATGTTAATTAATGCAATGCTTGAAATA
GGCTACATATGTTACTTCAAAACAAAGGGTGTTATAGGGGAACAGACAAGGGGCATTCATAGGAGGCTGG
GACCAGAGAAGAAGAAGGAGTATCAGGGCAGGCTCCCTGAAGAAGGTGGGACAAATGGATTGAAAGTTGT
GGGAGACTTCATTTCCAGAAGTGAACATGTCAGGGGCATACAGGAAGGAGGGAAATAAAGACCTGAAAGT
CAAAAAGGATGATATGAGGCCTGGAGCCTCTAATGCAGAGTTTTCACTTTAAGATCCCCCCCATTCCCTT
GTTGGATACAGTGAAGCCCAAGGCCTGGCTGTCCCGTGGCCCCAGTCCTGGCCCTGGCCGTCTGCTGCTG
GTGTGCCATGTCTCAGGATTCTACCCAAAGCCTGTATGGGTGAAGTGGATGCGGGGTGAGCAGGAGCAGC
AGGGCACTCAGCCAGGGGACATCCTGCCCAATGCTGACGAGACATGGTATCTCCGAGCAACCCTGGATGT
GGTGGCTGGGGAGGCAGCTGGCCTGTCCTGTCGGGTGAAGCACAGCAGTCTAGAGGGCCAGGACATCGTC
CTCTACTGGGGTGAGAAAAAGCTGGGCCCAAGCTGGAAATGGCAGGAGGTGGTCCTCAGGCATAGAGGGA
GGCACTGGGGTGGGATGTGGCTTGATATACCCAGGTTAGAGGAGTTTCAGAGATGAGGCCCCCAGTAAAA
GGATAGAGAGAGGGGTTCCAGACACAGGAAGGAGGGAAATAAAGACCTGAAAGTCTAAAAGGATTGAAAT
AGTGCTCTCTATATACAAGAAGAAACAAGACTACAAAACTCAGGGATCCAGAAGTAGGCAGCGAATAAAC
AATCCCAGGACGATTCATTCCTTGGCTTAAAGGGAGCCAGGCCTTTGGGAAGGCAGGTTAGCAAAGATAG
CTTGGTTGGTTGAGTGCTCCCTGTGTAGGGGCCAATGAATCTGCATATAATATCTCATCTCATCATTCAC
AGTTTTCTTTGAAGCAAGTACTGCTCTTTTCGTTATATAGATGAGGAAATGAAGGCGGAGATAGGTTAAC
TGCCCGGAGCCACATAGAAAGTGGACGGGCTGGATTTAGATTCAGGTCTGCCTTGCTACAAAGCTGTTGC
CCTTTCCCTCTATGCTACACTAGCAAATGTCAAAGTGGGCTGAATTTGGGATGCCCAGGCACTGAAAACA
AGATGGGGAATCTAAACTTATGAGGAATAGAAATTGGGGTTTTAAGTGGAGGAGGAAATAAGAAGCACCT
GGTACCCTCACACATGCCTAGACCAGGGGATTGGATATATGTAGAGAGGGGTCCTGTGCTGAGAGACAGC
CTATGTTCCTCCAGAGCAGGTGGGAGCTACACCTCCATGGGCTTGATTGCCTTGGCAGTCCTGGCGTGCT
TGCTGTTCCTCCTCATTGTGGGCTTTACCTCCCGGTTTAAGAGGCAAACGTAAGTCTCCCCTTTCCCTTT
CCTCAACCTCTCTCCCCTTCATTCCTGGCTTCCCTTTTCCTTAATGGTCTTTCCCTTTCTATTCTCTCAC
AGTTCCTATCAGGGCGTCCTGTGACTCGCCTTGCCACATCTGTGTCTCTGGAACCCAGGACCTCTGGACC
TCAGGTTCCTAAGACTTCAGTCCTGGTCTGCTCAGGAATTGAAGATGTAAGGAATTGAAGATAGGAGAGA
TACCTTGAAAAAGTAGAGAACAGTCATGAGGCAGCTTTCATCACACCCTTTTAACATTTATCTAAAAGAA
TTTAAATTCTTTTTCAAAAATTACACTACAAGTTTATAAGCCCAAATGGCTCTGTGAAATCAGAAGTGCA
AAGGTGTGCAAACTTGTATCTGAAGACCTACCAGGGACAAGCAGGTAAGAGCTGATGTGAGTGTGTGTGA
TGGGATCTGTAAGGAACTGGAACACACATGTCCTATCCAAAGGAATCAGCTGCAGCTGCTTGTTGTCAAG
TATAAAGTCAGGACCTGGCTTGGCTTTAACCGTTTTTCAAGAAAACTGGAAATCTGGATTTTCAGCGAAC
ATGCCTGATTTTAAAAGGTTGACTCAAGTTTTTACAAAATACTATGTGGGACACCTCAAATACATACCTA
CTGACTGATGACAAACCCAGGAGTTTGTGTGTCTTTTATAAAAAGTTTGCCCTGGATGTCATATTGGCAG
TTGGAGGACACAGTTTCTATTGTAAATTTGGATTTACGACTGAAGAAGGACATTTTCTCTTTAAAAGAAA
GTTAGGTTATAAGAAACAGAGGCGTCTCACATTTTTACTTGGTGTAATTAATAAACGAAGATAAATCATA
GTGTATGTGTATTATGTTGAAAAAAACTACTCTGAGTAAGGATATTTCTCTCAAATGGTCATCACTTTTT
TTCCTTGGAGGAAGATTGTCATGAAGGCATCCCTTCCTTCCCAAAACGACAACGGCAACAACAACAGTCT
CCTTTACTTACAGCTATTAAAAGAGACAATGTAGGGAAAGGGCCAACACCACTTGGGCAAGCATGAGCTG
CAGCGATGATGGTGATGGTAGCCCAGCCATGCTGTGTTCTTATCTTAGAGAGGACAGAGCAGGAAACTTA
CAGGGGTAGCAGACCTTTCTGATGCCAAAGAAATAAGGAGGCCAAAATCATGTTTGCCTAGCTGGGAGGT
AAATCTCTTGGCAGTCAGGGTCCCTGAACACCCAGAAAAAATAAGTGAGACTTAACGGTTGGAGAGTGTT
TGCTTGAGAAAAGTAACATTTCACACTCTCTATACTAGACTTGCACATATGAATTTAGGATGTGCGTGAA
GATTCTGCTAGCTTCAACATATCCCAAAGCACTTGGATATGCCTATAATCCAAGTGCTTTGGGAGGCTGA
GATAGGAGGATTGTTTAAGGCCAGGCATTTGAAATCAGCCTGGGCAACATAGTGAGACCCTGTCTCTACA
AAAAATTAAAAAACTAGCCACCCATGGTGGTGAGCGCCTGTAGTCCTAGCTACTCTGGAGGCTGAGGTGG
GAGGATCCCTTGAGCCCATGAATTCCAGGTTAGTGTGAGCTGTGATTGTGTCACTACAGTGTAAGGATGA
CAGAGGGAGACCCTGTCTTAAAAAAAAATTATGCTAGCTTTTAAATCAATGGTTCCCAAATTGTAGTAAC
CTGACCAACAGCCTCAGCAGGACCTGGGAACTTGTTATAAATGCAAATTGTTTTGGGCCTCATCCTATAC
CCGCTGAATGAGAAACTCTGAGTCTGGAAGCAGGCTCAATAGTCAAGCCCCCTGGTGATTCTGATGCTTA
GCTAAAGTTAGAGAACCACTGTTCTTAGACATTGTGCAATGTTATACAACAACTTCCTCAAAGTGCTAAG
TGAAAAGGACATTGGCCTGGCGTTAGTCAGGGAAGGCGTCCTGGAGGGAGGGGAATTTGAAGCAGAGCTT
TGAAAAACAAAGGCAGTGAGGTGAACCAGCAAGTGCACTGGCTGAGGGGACTGGAGTTCTAGCCTCTGAA
CCAGTTTCCTCCTGTGCCAAAGGAGGATAATAATTATCTATTATTGATTATCTCCTAGACTTGTGGAGTT
CAAGTGTGTAATGCCTTAAAAGATGTGGAGGCTGTTGCTGTGTTTGGTACCACATTGCCCACCCTCACGT
GGCGCTCTTCAGCTTAGGTTCCTCTAGCAGTGTCAAGTTTGTGAACCAACCCCACTGGCCTTCTGCATTC
TGAGGGCACGTGTGTTAAAGTCTCTACTGATGTCCTTTTGGAAATGCCTCTGCATGAATTTATGGTAGCT
CTGACTCATCTTTAAACAATTTTAATTTATTTAGAAAATAAAGGCTTATCTCTCCAGGAA

Protein Sequence
>NP_001306074.1 antigen-presenting glycoprotein CD1d isoform 2 precursor [Homo sapiens]
MGCLLFLLLWALLQAWGSAEVPQRLFPLRCLQISSFANSSWTRTDGLAWLGELQTHSWSNDSDTVRSLKP
WSQGTFSDQQWETLQHIFRVYRSSFTRDVKEFAKMLRLSYPLELQVSAGCEVHPGNASNNFFHVAFQGKD
ILSFQGTSWEPTQEAPLWVNLAIQVLNQDKWTRETVQWLLNGTCPQFVSGLLESGKSELKKQGGSYTSMG
LIALAVLACLLFLLIVGFTSRFKRQTSYQGVL

Molecule Role Protective antigen
Related Vaccines(s) FluMist
References