VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

NEAT

Gene Name NEAT
Sequence Strain (Species/Organism) Bacillus anthracis
NCBI Protein GI WP_080489610
Other Database IDs CDD:309946
CDD:132993
CDD:227223
CDD:275380
CDD:275378
CDD:306825
Taxonomy ID 1392
Gene Strand (Orientation) ?
Protein Name NEAT domain-containing leucine-rich repeat protein
Protein pI 5.8
Protein Weight 81601.3
Protein Length 872
Protein Note Iron Transport-associated domain; pfam05031
Protein Sequence
>WP_080489610.1 NEAT domain-containing leucine-rich repeat protein [Bacillus anthracis]
MIGDIILKKIYMKALVVATTLAIPFAAYSTPALAAIKIEANQSVAASDRTYDTEIKIYKDQKDEPSMVSQ
YIKDPKVAIVAGKKIVTVTMQDSDYFQYLRIEDRNQPGVFHDVKVLSEDKRKNGTKVIQFEIGEFEKKHN
MQMHILIPAIGYDHKYQVQFEIKDPTVGDKETEKPDDNSNSGNTETDKPVDNQNMITDNKLRELVNKKVF
NRKDVNTPITKEELLQVKNLFLNTNEILDYSALKYMPNLKSLTVANAKIKDPSFFANLKQLNHLALRGNE
FSDVTPLVKMDHLDSLDLSNNKITNVAPLIEMKNVKSLYLSGNQIEDVTALAKMEQLDYLNLANNKITNV
APLSALKNVTYLTLAGNQIEDIKPLYSLPLTDLVLTRNKVKDLSGIEQMKQLEELWIGKNEIKDVTPLSK
MTQLKQLHLPNNELKDITPLSSLVNLQKLDLEANYISDLTPASNLKKLVFLSFVANEIRDVRPVIELSKT
AYINVQNQKVFLEETEVNKEVKVPIYEKDGKISTKIRLKDEGGTYSNDAVKWSTPGEKVYEFGVKDPFAD
TGIFFTGSVIQNVVESKADNISKEDNTSKEDAKVEVVEFKDVPKGHWSEEAIHYLAKENIFKGYGNGQFG
FGDSITRGQVASLVQRYLKLENKVEQKERFTDTKGHMFEQDIATVAQAGIMQGDGTGEFRPDGVLTRYEM
SVVLYKVFQLKEDGNNKVNFKDVPTGHWAEGYVKALVDNNISKGDGKERFLGDDFVTREQYAQFLYNAIT
K

Molecule Role Protective antigen
Molecule Role Annotation (Balderas et al., 2016)
References