VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

ligA

Gene Name ligA
Sequence Strain (Species/Organism) Leptospira kirschneri serovar Kambale
NCBI Protein GI ACH98094
Other Database IDs CDD:214752
CDD:308144
CDD:322060
Taxonomy ID 173
Protein Name LigA
Protein pI 6.12
Protein Weight 119806.65
Protein Length 1285
Protein Note serogroup: Canicola
Protein Sequence
>ACH98094.1 LigA [Leptospira interrogans]
MKKIFCISIFLSMFFQSCMSWPLLTSLAGLAAGKRGGDSSFFHLLLGNSDPTITRIELSYQDSSIANGTS
TTLEVTAIFDNGTNQNITDSTSIVPDSQSVVTIQGNRVRGIASGSSIIKAEYNGLYSEQKITVTPATLNS
IQVTSLESGILPKGTNRQFSAIGIFSDGSHQDISNDPLIVWSSSNPDLVQVDDSGLASGINLGTAHIRAS
FQSKQGAEEMTVGDAVLSQIQVTSNNPNIPLGKKQKLIATGIYSDNSNRDISSSVIWNSSNSTIANIQNN
GILETADTGIVTISASSENIIGSVKLIVTPAALVSISVSPTNSTVAKGLQENFKATGIFTDNSNSDITDQ
VTWDSSNTDILSISNASDSHGLASTLNQGNVKVTASIGGIQGSTDFTVTQAALTSIEVSPVLPSIAKGLT
QKFTAIGIFTDNSKKDITDQVTWNSSSAIVSVSNLDDNKGLGKAHAVGDTTITATLGKVSGKTWLTVVPA
VLTSIQINPVNPSLAKGLTQKFTATGIYSDNSNKDITSAVTWFSSDSSIATISNAQKNQGNAYGAATGAT
DIKATFGKVSSPVSTLSVTAAKLVEIQITPAAASKAKGLTERFKATGIFTDNSNSDITNQVTWNSSNTDI
LTVSNTNAKRGLGSTLKQGTVKVTASMGGIEDSVDFTVTQATLTSIEVSPTRASIAKGMTQKFTATGIFT
DHSKKNITEQVTWKSSSKALSMLNAPGEEGTGKAIAVGNISITATLEKLSGKTDITVTPAVLTSIQISPV
KHCLVKGLTEKFSATGIYSDNSSKDITSAVTWHSSNNSVATISNTKGYQGQAHGTGTGTVDIKATLGNVS
SQVSKLSVTAAELIEIVLNPTSSHKAKGLTENFKATGVFTDNSTKDITDQVTWKSSNTAYAKISNATGSK
GVVNALSKGTSHISATLGSISSANATFQVTPAKVVSIEVIPNNISFAKGNSYQFKATGIYTDHSEADITE
QVTWSSSNPKIASVENTFGSAGLVNTTNIGSTNITAKLSDTVSGSSVLNVTPALLRYIMITPSYAGIEKG
YTKQFSAIGTYSDQSTKDLTEDVTWFSSNPSSVVIENTPGKKGLAFASELGEPDITVFYDHHTQSSYTPV
TVTESGIVNITISLSSISKTKGSTHQFKATGKFENGAEIDLTELVTWSSSNPTVVSISNVDDERGLATAL
SVGSSKISVDYNSISSSIDFEVTPEILASIKTEP
Molecule Role Protective antigen
Molecule Role Annotation (Evangelista et al., 2017)
References