VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

ligB

Gene Name ligB
Sequence Strain (Species/Organism) Leptospira interrogans serovar Pomona
NCBI Protein GI ACH89908
Other Database IDs CDD:295441
CDD:214752
CDD:280521
Taxonomy ID 44276
Protein Name LigB
Protein pI 7.08
Protein Weight 190537.51
Protein Length 1983
Protein Note Bacterial Ig-like domain (group 2); cl02708
Protein Sequence
>ACH89908.1 LigB, partial [Leptospira interrogans serovar Pomona]
MKKIFCISIFLSMFFQGCMSWPLLTGLVGLTAGKKSNGLSFFHLLLGNSNPTITRIELSYQDSSIANGTS
TTLEVTAIFDNGTNQNITDSTSIVPDSQSVVTIQGNRVRGIASGSSIIKAEYNGLYSEQKITVTPATLNS
IQVTSLGSGILPKGTNRQFSAIGIFSDGSHQDISNDPLIVWSSSNPDLVQVDDSGLASGINLGTAHIRAS
FQSKQGAEEMTVGDAVLSQIQVTSNNPNIPLGKKQKLIATGIYSDNSNRDISSSVIWNSSNSTIANIQNN
GILETVDTGIVTISASSENIIGSVKLIVTPAALVSISVSPTNSTVAKGLQENFKATGIFTDNSNSDITDQ
VTWDSSNTDILSISNASDSHGLASTLNQGNVKVTASIGGIQGSTDFKVTQAALTSIEVSPVLPSIAKGLT
QKFTAIGIFTDNSKKDITDQVTWNSSSAIVSVSNLDDNKGLGKAHAVGDTTITATLGKVSGKTWLTVVPA
VLTSIQINPVNPSLAKGLTQKFSATGIYSDNSNKDITSAVTWFSSDSSIATISNAQKNQGNAYGAATGAT
DIKATFGKVSSPVSTLSVTAAKLVEIQITPAAASKAKGLTERFKATGIFTDNSNSDITNQVTWNSSNTDI
AEITNTSGSKGITNTLTPGSSEISAALGSIKSSKVILKVTPAQLISIAVTPINPSVAKGLIRQFKATGTY
TDHSVQDVTALATWSSSNPRKAMVNNVTGSVTTVATGNTNIKATIDSISGSSVLNVTPALLTSIEITPTI
NSITHGLTKQFKATGIFSDKSTQNLTQLVTWISSDPSKIEIENTSGKKGIATASKLGSSNIKAVYKFIQS
SPIPITVTDLKLKSITISPSSSSIAKGLTQQFKAIGTFIDGSEQEITNLVTWYSSKSDVAPINNAANEKG
LATALSIGSSDIYAIYNSISSNKINFNVSAATLDSIKINPVNNNIAKGLTQQYTALGVYSDSTIQDISDS
VTWSSSNSSSISISNSTETKGKATALQIGNSKITATYNSISENIDITVSAATLSSISISPINTNINTTVS
KQFFAVGTYSDGTKADLTSSVTWSSSNQSQAKVSNASETKGLVTGIASGNPTIIATYGSVSGNTILTVNK
TDTIAPTVQSVVSLSPTTIQVVYSESINNKEALDLSNYKIINSSNFIGHCSDNTDFNSNSQTADFSLSSI
KGSKNTFTITLSHSQILNKSYTLVVNKQGIHDLSSIPNSLSCPNNSDFMGKEQLKLTSAVCNSLNQVIVS
FSKPLYSGKEVTKSVECSNPSQCESRYKFAGVSSLGSITSVRILDGKVCGGAPADSSKICLTHSLLQSGG
QYTIIAANDLNGDGFDNKSWGAIRDSFDQENLQPSPKDRINFIGCGNSPLNFMDGPIVSDPFGDGSDFGS
LVDYNNQIYLGPNVKGNQATRFHYDGTFPESIFFSFTKDINATNRASSRDGGIPVPNYVTIGHTGCTLNT
ADITTGCGPDNENGRGVFATGSLNKKSHIFIAGSKPKRFNYLYYSSDTDTNLDFKYIDMGEITGLATAGT
SSIAVLDDRIHVGFAKRNQNLNAPDFGKITFNTSEQNRCAAGNNCEASDGYRGNRFRIDRMPYFGGGSVD
AVNYRTYKSDNSSINWGYYVGIDSLFVFKEKLYAANGGFPNSLHNGSIIHSTSANPSPCEEINRCSNWKD
TAPRSNPKWHNSPHNNWFSLELTKYRNLIPADKAFSQFAEFNGRLYVTRTICVTKEDNSGLRQSLQTVEG
CTDGSYTNRRPQLWKCDPTLTGDTTTCEAEDWSLVGDDGTGFTNFGDHSNHSMTMMVASGSYLYIGFDNE
NGIQIWRTNLENPGSSSHDWEPIGIGGLRDVTNRQIYSAISGMNFGVNFVYISVGNKNKPVKIYRQQNQ

Molecule Role Protective antigen
Molecule Role Annotation (Conrad et al., 2017)
References